рефераты, курсовые, дипломы >>> биология, химия

 

Белки: история исследования, химсостав, характеристики, биологические функции

 

Глава 1. Введение.

достаточно банальными стали сейчас сообщения о революции в биологии. Бесспорным считается и то, что эти революционные конфигурации были соединены с формированием на стыке биологии и химии комплекса наук, посреди которых центральное положение занимали и занимают молекулярная биология и биоорганическая химия.

“Молекулярная биология - наука, ставящая собственной целью познание природы явлений жизнедеятельности методом исследования биологических объектов и систем на уровне, приближающемся к молекулярному… характерные проявления жизни… обусловлены структурой, качествами и взаимодействием молекул биологически принципиальных веществ, в первую очередь белков и нуклеиновых кислот

“Биоорганическая химия - наука, изучающая вещества, лежащие в базе действий жизнедеятельности…основные объекты биоорганической химии - биополимеры (белки и пептиды, нуклеиновые кислоты и нуклеотиды, липиды, полисахариды и т.Д.).

Из этого сопоставления становится естественным, сколь принципиально для развития современной биологии исследование белков.

Глава 2. История исследования белка

2.1. Начальные этапы в химии белка

Белок попал в число объектов химических исследований 250 лет тому назад. В 1728 году итальянский ученый Якопо Бартоломео Беккари получил из пшеничной муки первый продукт белкового вещества – клейковины. Он подверг клейковину сухой перегонке и убедился, что продукты таковой перегонки были щелочными. Это было первое подтверждение единства природы веществ растительного и животного царств. Он опубликовал результаты собственной работы в 1745 году, и это была первая статья о белке.

В XVIII – начале XIX веков не один раз обрисовывали белковые вещества растительного и животного происхождения. Особенностью таковых описаний было сближение этих веществ и сопоставление их с веществами неорганическими.

принципиально отметить, что в это время, еще до появления элементного анализа, сложилось представление о том, что белки из разных источников – это группа близких по общим свойствам личных веществ.

Формулы белков

Д. Дальтона

В 1810 году Ж. Гей-Люссак и Л. Тенар в первый раз определили элементный состав белковых веществ. В 1833 году Ж. Гей-Люссак доказал, что в белках непременно находится азот, а скоро было показано, что содержание азота в разных белках приблизительно одинаково. В это же время английский химик Д. Дальтон попытался изобразить первые формулы белковых веществ. Он представлял их достаточно просто устроенными веществами, но чтоб выделить их личное различие при одинаковом составе, он прибег к изображению молекул, которые бы сейчас окрестили изомерными. Но понятия изомерии во времена Дальтона еще не было.

Были выведены первые эмпирические формулы белков и выдвинуты первые гипотезы относительно закономерностей их состава. Так, Н.Либеркюн считал, что альбумин описывается формулой C72H112N18SO22, а А.Данилевский полагал, что молекула этого белка по крайней мере на порядок больше: C726H1171N194S3O214.

германский химик Ю. Либих в 1841 году предположил, что белки животного происхождения имеют аналоги посреди растительных белков: усвоение белка легумина в организме животного, по Либиху, вело к скоплению аналогичного белка – казеина. Одной из самых распространенных теорий доструктурной органической химии была теория радикалов – постоянных компонентов родственных веществ. В 1836 году голландец Г. Мульдер высказал предположение о том, что все белки содержат один и тот же радикал, который он назвал протеином (от греческого слова “первенствую”, “занимаю первое место”). Протеин, по Мульдеру, имел состав Pr = C40H62N10O12. В 1838 году Г. Мульдер опубликовал формулы белков, построенные на основании теории протеина. Это были т.Н. Дуалистические формулы, где радикал протеина служил положительной группировкой, а атомы серы либо фосфора – отрицательной . совместно они образовывали электронейтральную молекулу: белок сыворотки крови Pr10S2P, фибрин Pr10SP. Но аналитическая проверка данных Г. Мульдера, проведенная российским химиком Лясковским, а также Ю. Либихом, показала, что “белковых радикалов” не существует.

В 1833 году германский ученый Ф. Розе открыл биуретовую реакцию на белки – одну из главных цветных реакций на белковые вещества и их производные в настоящее время (подробнее о цветных реакциях на стр.53). Был сделан также вывод о том, что это самая чувствительная реакция на белок, поэтому она в то время завлекла наибольшее внимание химиков.

В середине XIX века были разработаны бессчетные способы экстракции белков, очистки и выделения их в растворах нейтральных солей. В 1847 году К. Рейхерт открыл способность белков образовывать кристаллы. В 1836 году Т. Шванн открыл пепсин – фермент, расщепляющий белки. В 1856 году Л. Корвизар открыл еще один схожий фермент – трипсин. Изучая действие этих ферментов на белки, биохимики пробовали разгадать тайну пищеварения. Но наибольшее внимание внимание завлекли вещества, получающиеся в итоге деяния на белки протелитических фермнтов (протеаз, к ним относятся вышеприведенные ферменты): одни из них были фрагментами исходных молекул белка (их окрестили пептонами), остальные же не подвергались дальнейшему расщеплению протеазами и относились к известному еще с начала века классу соединений – аминокислот (первое аминокислотное производное – амид аспарагин был открыт в 1806 году, а первая аминокислота – цистин в 1810). Аминокислоты в составе белков в первый раз нашел в 1820 году французский химик А. Браконно. Он применил кислотный гидролиз белка и в гидролизате нашел сладковатое вещество, названное им глицином. В 1839 году было подтверждено существование в составе белков лейцина, а в 1849 году Ф. Бопп выделил из белка еще одну аминокислоту – тирозин (полный перечень дат открытий аминокислот в белках см. Приложение II).

К концу 80-х гг. XIX века из белковых гидролизатов было выделено уже 19 аминокислот и стало медлительно укрепляться мировоззрение, что сведения о продуктах гидролиза белков несут важную информацию о строении белковой молекулы. Тем не менее, аминокислоты числились обязательным, но неглавным компонентом белка.

В связи с открытиями аминокислот в составе белков французский ученый П. Шютценберже в 70-х гг. XIX века предложил т. Н. уреидную теорию строения белка. Согласно ей молекула белка состояла из центрального ядра, роль которого выполняла молекула тирозина, и присоединенных к нему (с замещением 4 атомов водорода) слож ных группировок, названных Шютценберже лейцинами. но гипотеза было совсем слабо подкреплена экспериментально, и дальнейшие исследования проявили несостоятельность.

2.2. Теория “углеазотных комплексов” А.Я.Данилевского

Оригинальную теорию о строении белка высказал в 80-х гг. XIX века российский биохимик А. Я. Данилевский. Первым из химиков он направил внимание на вероятный полимерный характер строения белковых молекул. В начале 70-х гг. Он писал А.М. Бутлерову, что “частицы альбумина есть смешанный полимерид”, что для определения белка он не находит “термина более подходящего, чем слово полимер в широком смысле”. Изучая биуретовую реакцию он предположил, что эта реакция связана со структурой перемежающихся атомов углерода и азота – N – C – N – C – N – , которые входят в т.Н. углеазотный комплекс R’ – NH – CO – NH – CO – R”. На базе данной формулы Данилевский полагал, что в молекуле белка содержится 40 таковых углеазотных комплексов. Отдельные углеазотноаминокислотные комплекс, по Данилевскому, выглядели так:

R – NH – CO – NH – CO – NH – CH2 – COOH

Глицин

R – NH – CO – NH – CO – NH – C2H4 – COOH

Аланин

R – NH – CO – NH – CO – NH – C2H3(OH) – COOH

Серин

По Данилевскому углеазотные комплексы могли соединяться эфирной либо амидной связью с образованием высокомолекулярной структуры.

2.3. Теория “киринов” А.Косселя

германский физиолог и биохимик А. Коссель, изучая протамины и гистоны, относительно просто устроенные белки, он установил, что при их гидролизе появляется огромное количество аргинина. Не считая того он открыл в составе гидролизата неизвестную тогда аминокислоту – гистидин. На основании этого Коссель предположил, что эти белковые вещества можно разглядывать как некие простые модели более сложных белков, построенных, по его мнению, согласно следующему принципу: аргинин и гистидин составляют центральное ядро (“протаминовое ядро”), которое окружено комплексами из остальных аминокислот.

Теория Косселя представляла собой более совершенный пример развития гипотезы о фрагментарном строении белков (в первый раз предложенной, как было сказано выше, Г.Мульдером). данной гипотезой пользовался германский химик М. Зигфрид в начале XX века. Он полагал, что белки построены из комплексов аминокислот (аргинин+лизин+глутаминовая к-та), названных им киринами (от греческого “кириос” - основной). но эта гипотеза была высказана в 1903 году, когда Э. Фишер активно разрабатывал свою пептидную теорию, давшую ключ к тайне строения белков.

2.4. Пептидная теория Э.Фишера

германский химик Эмиль Фишер, уже прославившийся на весь мир исследованиями пуриновых соединений (алкалоидов группы кофеина) и расшифровкой структуры сахаров, создал пептидную теорию, во многом подтвердившуюся фактически и получившую всеобщее признание еще при его жизни, за что он был удостоен второй в истории химии Нобелевской премии (первую получил Я.Г. Вант-Гофф).

важно, что Фишер выстроил план исследования, резко отличающийся от того, что предпринималось ранее, но учитывающий все известные на тот момент факты. До этого всего он принял, как более вероятную гипотезу о том, что белки построены из аминокислот, соединенных амидной связью:

R – CH – NH – CO – CH – R’

| |

HOOC NH2

таковой тип связи Фишер назвал (по аналогии с пептонами) пептидной. Он предположил, что белки представляют собой полимеры аминокислот, соединенных пептидной связью. мысль о полимерном характере строения белков как понятно высказывалась еще Данилевским и Хертом, но они считали, что “мономеры” представляют собой совсем сложные образования – пептоны либо “углеазотные комплексы”.

Доказывая пептидный тип соединения аминокислотных остатков. Э. Фишер исходил из следующих наблюдений. Во-первых, и при гидролизе белков, и при их ферментативном разложении образовывались разные аминокислоты. Остальные соединения было очень тяжело обрисовать а еще труднее получить. Не считая того Фишеру было понятно, что у белков не наблюдается преобладания ни кислотных, ни главных параметров, означает, рассуждал он, амино- и карбоксильные группы в составе аминокислот в белковых молекулах замыкаются и как бы маскируют друг друга (амфотерность белков, как произнесли бы сейчас).

Решение трудности строения белка Фишер поделил, сведя её к следующим положениям:

1) Качественное и количественное определение товаров полного гидролиза белков.

2) Установление строения этих конечных товаров.

3) Синтез полимеров аминокислот с соединениями амидного (пептидного) типа.

4) Сравнение полученных таковым образом соединений с природными белками.

Из этого плана видно, что Фишер применил в первый раз новый методологический подход – синтез модельных соединений, как метод подтверждения по аналогии.

2.5. Разработка способов синтеза аминокислот

Для того чтоб перейти к синтезу производных аминокислот, соединенных пептидной связью, Фишер провел огромную работу по исследованию строения и синтезу аминокислот.

До Фишера общим способом синтеза аминокислот был циангидринный синтез А. Штреккера:

+ NH3;HCN +H+;H2O

RR’C=O RR’C(NH2)CN RR’C(NH2)COOH

По реакции Штреккера удалось синтезировать аланин, серин и некие остальные аминокислоты, а по её модификации ( реакции Зелинского-Стадникова) как a-аминокислоты, так и их N-замещенные.

но сам Фишер стремился создать способы синтеза всех узнаваемых тогда аминокислот. Он считал способ Штреккера недостаточно универсальным. Поэтому Э. Фишеру пришлось находить общий способ синтеза аминокислот в том числе аминокислот со сложными боковыми радикалами.

Он предложил аминировать бромзамещенные в a-положении карбоновые кислоты. Для получения бромпроизводных он употреблял, как к примеру, в синтезе лейцина, арилированную либо алкилированную малоновую кислоту:

Br2 – CO2

(CH3)2CHCH2CH(COOH)2 (CH3)2CHCH2CHBr(COOH)2

NH3

(CH3)CHCH2CHBrCOOH (CH3)2CHCH2CHNH2COOH

Но сделать полностью универсальный способ Э. Фишеру не удалось. Были разработаны и более надежные реакции. К примеру, ученик Фишера Г. Лейкс предложил следующую модификацию для получения серина:

HCN

C2H5OCH2CHO C2H5OCH2CH(NH2)CN

HBr

C2H5OCH2CH(NH2)COOH HOCH2CHNH2COOH

Фишер также доказал, что белки состоят из остатков оптически активных аминокислот (см. Стр.11). Это принудило его создать новенькую номенклатуру оптически активных соединений, способы разделения и синтеза оптических изомеров аминокислот. Фишер также пришел к выводу, что в белках содержатся остатки L-форм оптически активных аминокислот, и он доказал это, в первый раз использовав принцип диастереоизомерии. Этот принцип заключался в следующем: к N-ацилпроизводному рацемической аминокислоты добавляли оптически активный алкалоид (бруцин, стрихнин, цинхонин, хинидин, хинин). В итоге этого образовывались две стереоизомерные формы солей, владеющие различной растворимостью. После разделения этих диастереоизомеров алкалоид регенерировали и ацильную группу удаляли методом гидролиза.

Фишер смог создать способ полного определения аминокислот в продуктах гидролиза белков: он переводил хлоргидраты эфиров аминокислот обработкой концентрированной щелочью на холоду в свободные эфиры, которые заметно не омылялись. Потом смесь этих эфиров подвергал фракционной перегонке и из полученных фракций выделял отдельные аминокислоты методом дробной кристаллизации.

Новый способ анализа не лишь совсем подтвердил, что белки состоят из аминокислотных остатков, но дозволил уточнить и пополнить перечень встречающихся в белках аминокислот. Но все же количественные анализы не могли дать ответа на основной вопрос: каковы принципы строения молекулы белка. И Э.Фишер определил одну из главных задач в исследовании строения и параметров белка: разработка экспериментальные способы синтеза соединений, основными компонентами которых были бы аминокислоты, соединенные пептидной связью.

таковым образом Фишер поставил нетривиальную задачку – синтезировать новый класс соединений с целью установления принципов их строения.

задачку эту Фишер решил, и химики получили убедительные подтверждения, что белки представляют собой полимеры аминокислот, соединенных пептидной связью:

««« – CO – CHR’ – NH – CO – CHR’’ – NH – CO CHR’’’ – NH – «««

Это положение подтверждалось биохимическими подтверждениями. Попутно выяснилось, что протеазы гидролизуют не все связи меж аминокислотами с одинаковой скоростью. На их способность расщеплять пептидную связь влияли оптическая конфигурация аминокислот, заместители по азоту аминогруппы, длина цепи пептида, а также набор входящих в него остатков.

основным подтверждением пептидной теории стал синтез модельных пептидов и сопоставление их с пептонами гидролизата белков. Результаты проявили, что из белковых гидролизатов выделяются пептиды, идентичные синтезированным.

В процессе выполнения этих исследований Э.Фишер и его ученик Э.Абдергальд- ен в первый раз разработали способ определения аминокислотной последовательности в белка. Сущность его заключалась в установлении природы аминокислотного остатка полипептида, имеющего свободную аминогруппу (N-концевую аминокислоту). Для этого они предложили перекрыть в пептиде аминоконец b-нафталин-сулфониловой группой, которая не отщепляется при гидролизе. Выделяя потом из гидролизата аминокислоту, меченую таковой группой, можно было найти, какая из аминокислот была N-концевой.

После исследований Э.Фишера стало ясно, что белки представляют собой полипептиды. Это было принципиальное достижение, в том числе и для задач синтеза белков: стало ясно, что конкретно необходимо синтезировать. Лишь после этих работ неувязка синтеза белка заполучила определенную направленность и нужную строгость.

Говоря о работе Фишера в целом, следует отметить, что сам подход к исследованию был типичен быстрее для наступающего XX века – он оперировал широким набором теоретических положений и методических приемов; его синтезы все менее и менее походили на искусство, основанное на интуиции, чем на чётком знании, и приближались к созданию серий чётких, практически технологических приемов.

2,6, Кризис пептидной теории

В связи с применением новейших физических и физико-химических способов исследований в начале 20-х гг. XX в. Возникли сомнения в том, что молекула белка представляет длинную полипептидную цепь. К гипотезе о способности компактной укладки пептидных цепочек относились со скептицизмом. Все это потребовало пересмотра пептидной теории Э.Фишера.

В 20-30-е гг. Распространение получила дикетопиперазиновая теория. Согласно ей, центральная роль в построении структуры белка играются дикетопиперазивные кольца, образующиеся при циклизации двух аминокислотных остатков. Также предполагалось, что эти структуры составляют центральное ядро молекулы, к которому присоединены короткие пептиды либо аминокислоты (“наполнители” циклического скелета основной структуры). более убедительные схемы роли дикетопиперазинов в построении структуры белка были представлены Н.Д.Зелинским и учениками Э.Фишера.

но пробы синтеза модельных соединений, содержащих дикетопиперазины не достаточно, что дали для химии белка - потом восторжествовала пептидная теория, но эти работы оказали стимулирующее влияние на химию пиперазинов в целом.

После пептидной и дикетопиперазивной теорий продолжались пробы доказать существование лишь пептидных структур в молекуле белка. При этом стремились представить себе не лишь тип молекулы, но и общие её очертания.

Оригинальную гипотезу высказал русский химик Д.Л.Талмуд. Он предположил, что пептидные цепи в составе белковых молекул свернуты в огромные кольца, что в свою очередь стало шагом к созданию им представления о белковой глобуле.

сразу возникли данные, свидетельствующие о различном наборе аминокислот в разных белка. Но закономерности, которым подчиняется последовательность аминокислот в структуре белка, были не ясны.

Первыми ответ на этот вопрос пробовали дать М.Бергман и К.Ниман в разработанной ими гипотезе “перемежающихся частот”. Согласно ей последовательность аминокислотных остатков в белковой молекуле подчинялась числовым закономерностям, базы которых были выведены из принципов строения белковой молекулы фиброина шелка. Но этот выбор был плохим, т.К. Этот белок фибриллярный, строение же глобулярных белков подчиняется совершенно иным закономерностям.

По М.Бергману и К.Ниману, любая аминокислота встречается в полипептидной цепи через определенной интервал либо, как говорил М.Бергман, владеет определенной “периодичностью”.Эта периодичность определяется природой аминокислотных остатков.

Молекулу фиброина шелка они представляли себе следующим образом:

Gly·Ala·Gly·Tyr· Gly·Ala·Gly·Arg· Gly·Ala·Gly·x· Gly·Ala·Gly·x·

(Gly·Ala·Gly·Tyr· Gly·Ala·Gly·x· Gly·Ala·Gly·x· Gly·Ala·Gly·x)12

Gly·Ala·Gly·Tyr· Gly·Ala·Gly·x· Gly·Ala·Gly·x· Gly·Ala·Gly·Arg·

(Gly·Ala·Gly·Tyr· Gly·Ala·Gly·x· Gly·Ala·Gly·x· Gly·Ala·Gly·x)13

Гипотеза Бергмана-Нимана оказала существенное влияние на развитие химии аминокислот - огромное количество работ было посвящено её проверке.

В заключение данной главы следует отметить, что к середине XX в. Было накоплено довольно доказательств справедливости пептидной теории, главные её положения были дополнены и уточнены. Поэтому центр исследований белков в XX в. Лежал уже области исследования и поиска способов синтеза белка искусственным методом. Эта задачка была удачно решена, были разработаны надежные способы определения первичной структуры белка - последовательности аминокислот в пептидной цепи, разработаны способы химического (абиогенного) синтеза нерегулярных полипептидов (подробнее эти способы рассматриваются в гл.8, Стр.36), В том числе способы автоматического синтеза полипептидов. Это позволило уже в 1962 г. Наикрупнейшему английскому химику Ф.Сенгеру расшифровать структуру и синтезировать искусственным методом гормон инсулин, что ознаменовало новенькую эру в синтезе полипептидов - функциональных белков.

Глава 3. Химический состав белков.

3.1. Пептидная связь

Белки представляют собой нерегулярные полимеры, построенные из остатков a-аминокислот, общую формулу которых в аква растворе при значениях pH близких к нейтральным можно записать как NH3+CHRCOO – . Остатки аминокислот в белках соединены меж собой амидной связью меж a-амино- и a-карбоксильными группами. Пептидная связь меж двумя a-аминокислотными остатками традиционно именуется пептидной связью, а полимеры, построенные из остатков a-аминокислот, соединенных пептидными связями, называют полипептидами. Белок как биологически важная структура может представлять собой как один полипептид, так и несколько полипептидов, образующих в итоге нековалентных взаимодействий единый комплекс.

3.2. Элементный состав белков

Изучая химический состав белков, нужно выяснить, во-первых, из каких химических частей они состоят, во-вторых, - строение их мономеров. Для ответа на первый вопрос определяют количественный и качественный состав химических частей белка. Химический анализ показал наличие во всех белках углерода (50-55%), кислорода (21-23%), азота (15-17%), водорода (6-7%), серы (0,3-2,5%). В составе отдельных белков обнаружены также фосфор, йод, железо, медь и некие остальные макро- и микроэлементы, в разных, частенько совсем малых количествах.

Содержание главных химических частей в белках может различаться, за исключением азота, концентрация которого характеризуется большим постоянством и в среднем составляет 16%. не считая того, содержание азота в остальных органических веществах не достаточно. В согласовании с этим было предложено определять количество белка по входящему в его состав азоту. Зная, что 1г азота содержится в 6,25 г белка, отысканное количество азота умножают коэффициент 6,25 и получают количество белка.

Для определения химической природы мономеров белка нужно решить две задачки: поделить белок на мономеры и выяснить их химический состав. Расщепление белка на его составные части достигается с помощью гидролиза – долгого кипячения белка с сильными минеральными кислотами (кислотный гидролиз) либо основаниями (щелочной гидролиз). более частенько применяется кипячение при 110 ° С с HCl в течение 24 ч. На следующем этапе разделяют вещества, входящие в состав гидролизата. Для данной цели используют разные способы, почаще всего – хроматографию ( подробнее – глава “Методы исследования…”). основным частью разделенных гидролизатов оказываются аминокислоты.

3.3. Аминокислоты

В настоящее время в разных объектах живой природы найдено до 200 разных аминокислот. В организме человека их, к примеру, около 60. но в состав белков входят лишь 20 аминокислот, называемых время от времени природными.

Аминокислоты – это органические кислоты, у которых атом водорода a-углеродного атома замещен на аминогруппу – NH2. Следовательно, по химической природе это a-аминокислоты с общей формулой:

R

|

H – C a – NH2

|

COOH

Из данной формулы видно, что в состав всех аминокислот входят следующие общие группировки: – CH2, – NH2, – COOH. Боковые же цепи (радикалы – R ) аминокислот различаются. Как видно из Приложения I химическая природа радикалов разнообразна: от атома водорода до циклических соединений. Конкретно радикалы определяют структурные и функциональные особенности аминокислот.

Все аминокислоты, не считая простейшей аминоуксусной к-ты глицина (NH3+CH2COO-) имеют хиральный атом Ca и могут существовать в виде двух энантиомеров (оптических изомеров):

H H

Ca Ca

COO – COO –

NH3+ R R NH3+

L-изомер D-изомер

В состав всех изученных в настоящее время белков входят лишь аминокислоты L-ряда, у которых, если разглядывать хиральный атом со стороны атома H, группы NH3+, COO- и радикал R расположены по часовой стрелке. Необходимость при построении биологически важной полимерной молекулы строить её из строго определенного энантиомера очевидна – из рацемической смеси двух энантиомеров вышла бы невообразимо сложная смесь диастереоизомеров. Вопрос, почему жизнь на Земле базирована на белках, построеных конкретно из L-, а не D-a-аминокислот, до сих пор остается интригующей загадкой. Следует отметить, что D-аминокислоты довольно обширно распространены в живой природе и, более того, входят в состав биологически важных олигопептидов.

Из двадцати главных a-аминокислот строятся белки, но другие, довольно разнообразные аминокислоты образуются из этих 20 аминокислотных остатков уже в составе белковой молекулы. Посреди таковых перевоплощений следует в первую очередь отметить образование дисульфидных мостиков при окислении двух остатков цистеина в составе уже сформированных пептидных цепей. В итоге появляется из двух остатков цистеина остаток диаминодикарбоновой кислоты цистина (см. Приложение I). При этом возникает сшивка или внутри одной полипептидной цепи, или меж двумя различными цепями. В качестве маленького белка, имеющего две полипептидные цепи, соединенный дисульфидными мостиками, а также сшивки внутри одной из полипептидных цепей:

| |

GIVEQCCASVCSLYQLENYCN

| |

FVNQHLCGSHLVEALYLVCGERGFFYTPKA

принципиальным примером модификации аминокислотных остатков является перевоплощение остатков пролина в остатки гидроксипролина:

N – CH – CO – N – CH – CO –

CH2 CH2 CH2 CH2

CH2CHOH

Это перевоплощение происходит, причем в значимом масштабе, при образовании принципиального белкового компонента соединительной ткани – коллагена.

Еще одним очень принципиальным видом модификации белков является фосфорилирование гидроксогрупп остатков серина, треонина и тирозина, к примеру:

– NH – CH – CO – – NH – CH – CO –

| |

CH2OH CH2OPO32 –

Аминокислоты в аква растворе находятся в ионизированном состоянии за счет диссоциации амино- и карбоксильных групп, входящих в состав радикалов. Другими словами, они являются амфотерными соединениями и могут существовать или как кислоты (доноры протонов), или как основания (акцепторы доноров).

Все аминокислоты в зависимости от структуры разделены на несколько групп:

Ациклические. Моноаминомонокарбоновые аминокислоты имеют в собственном составе одну аминную и одну карбоксильную группы, в аква растворе они нейтральны. Некие из них имеют общие структурные особенности, что дозволяет разглядывать их совместно:

1. Глицин и аланин. Глицин (гликокол либо аминоуксусная к-та) является оптически неактивным – это единственная аминокислота, не имеющая энатиомеров. Глицин участвует в образовании нуклеиновых и желчных к-т, гема, нужен для обезвреживания в печени токсичных товаров. Аланин употребляется организмом в разных действиях обмена углеводов и энергии. Его изомер b-аланин является составной частью витамина пантотеновой к-ты, коэнзима А (КоА), экстрактивных веществ мускул.

2. Серин и треонин. Они относятся к группе гидрооксикислот, т.К. Имеют гидроксильную группу. Серин входит в состав разных ферментов, основного белка молока – казеина, а также в состав многих липопротеинов. Треонин участвует в биосинтезе белка, являясь незаменимой аминокислотой.

3. Цистеин и метионин. Аминокислоты, имеющие в составе атом серы. Значение цистеина определяется наличием в её составе сульфгидрильной ( – SH) группы, которая придает ему способность просто окисляться и защищать организм о веществ с высокой окислительной способностью (при лучевом поражении, отравлении фосфором). Метионин характеризуется наличием просто подвижной метильной группы, использующейся для синтеза принципиальных соединений в организме (холина, креатина, тимина, адреналина и др.)

4. Валин, лейцин и изолейцин. Представляют собой разветвленные аминокислоты, которые активно участвуют в обмене веществ и не синтезируются в организме.

Моноаминодикарбоновые аминокислоты имеют одну аминную и две карбоксильные группы и в аква растворе дают кислую реакцию. К ним относятся аспарагиновая и глутаминовая к-ты, аспарагин и глутамин. Они входят в состав тормозных медиаторов нервной системы.

Диаминомонокарбоновые аминокислоты в аква растворе имеют щелочную реакцию за сет наличия двух аминных групп. Относящийся к ним лизин нужен для синтеза гистонов а также в ряд ферментов. Аргинин участвует в синтезе мочевины, креатина.

Циклические. Эти аминокислоты имеют в собственном составе ароматическое либо гетероциклическое ядро и, как правило, не синтезируется в организме человека и обязаны поступать с пищей. Они активно участвуют в разнообразных обменных действиях. Так фенил-аланин служит главным источником синтеза тирозина – предшественника ряда биологически принципиальных веществ: гормонов (тироксина, адреналина), неких пигментов. Триптофан кроме роли в синтезе белка, служит компонентом витамина PP, серотонина, триптамина, ряда пигментов. Гистидин нужен для синтеза белков, является предшественником гистамина, влияющего на кровяное давление и секрецию желудочного сока.

Глава 4. Структура.

При исследовании состава белков было установлено, что все они построены по одному принципу и имеют четыре уровня организации: первичную, вторичную, третичную, а отдельные из них и четвертичную структуры.

4.1. Первичная структура

Представляет собой линейную цепь аминокислот, расположенных в определенной последовательности и соединенных меж собой пептидными связями. Пептидная связь появляется за счет a-карбоксильной группы одной аминокислоты и a-аминной группы другой:

Ci a

O - H2O O

H2N – CH – C + NH – CH – COOH H2N – CH – C ¾ NH – CH – COOH

| OH H | | |

R R1 R R

Пептидная связь вследствие p, p-сопряжения p-связи карбонильной группы и р-орбитали атома N, на котором находится не поделенная пара электронов, не может рассматриваться как одинарная и вращение вокруг нее фактически отсутствует. По данной же причине хиральный атом C a и карбонильный атом C k хоть какого i-го аминокислотного остатка пептидной цепи и атомы N и Сa(i+1)-го остатка находятся в одной плоскости. В данной же плоскости находятся карбонильный атом О и амидный атом Н ( но скопленный при исследовании структуры белков материал указывает, что это утверждение не совершенно строго: атомы, связанные с пептидным атомом азота, находятся не в одной плоскости с ним, а образуют трехгранную пирамиду с углами меж связями, совсем близкими к 120°. Поэтому меж плоскостями, образованными атомами Cia, Cik, Oi и Ni+1, Hi+1, Ci+1a , существует некий угол, отличающийся от 0°. Но, как правило, он не превосходит 1° и не играется особой роли). Поэтому геометрически полипептидную цепочку можно разглядывать как образованную таковыми плоскими фрагментами, содержащими каждый по шесть атомов. Взаимное размещение этих фрагментов, как и всякое взаимное размещение двух плоскостей, обязано определятся двумя углами. В качестве таких принято брать торсионные углы, характеризующие вращения вокруг s-связей N ¾ C a и C a ¾ C k.

Геометрия хоть какой молекулы определяется тремя группами геометрических черт её химических связей – длинами связей, валентными углами и торсионными углами меж связями, примыкающими к соседним атомам. Первые две группы в решающей мере определяются природой участвующих атомов и образующихся связей. Поэтому пространственная структура полимеров в основном определяется торсионными углами меж звеньями полимерного остова молекул, т.Е. Конформацией полимерной цепи. Торсионный угол, т.Е. Угол поворота связи А-В вокруг связи В-С относительно связи С-D, определяется как угол меж плоскостями, содержащими атомы А, В, С и атомы B, C, D.

В таковой системе возможен вариант, когда связи А-В и С-D расположены параллельно и находятся по одну сторону от связи В-С. Если разглядывать эту систему вдоль связи В-С, то связь А-В как бы заслоняет связь C-D, поэтому таковая конформация именуется заслоненной. Согласно рекомендациям интернациональных союзов химии IUPAC (International Union of Pure and Applied Chemistry) и IUB (International Union of Biochemistry), угол меж плоскостями ABC и BCD считается положительным, если для приведения конформации в заслоненное состояние методом поворота на угол не выше 180° ближнюю к наблюдающему связь необходимо поворачивать по часовой стрелке. Если эту связь для получения заслоненной конформации необходимо поворачивать против часовой стрелки, то угол считается отрицательным. Можно заметить, что это определение не зависит от того, какая из связей находится ближе к наблюдающему.

При этом, как видно из рисунка, ориентация фрагмента, содержащего атомы Ci-1a и Cia [(i-1)-й фрагмент], и фрагмента, содержащего атомы Cia и Ci+1a (i-й фрагмент), определяется торсионными углами, соответствующими вращению вокруг связи Ni¾Cia и связи Cia¾Cik. Эти углы принято обозначать как j и y, в приведенном случае соответственно ji и yi. Их значениями для всех мономерных звеньев полипептидной цепи в основном определяется геометрия данной цепи. Никаких однозначных величин ни для значения каждого из этих углов, ни для их композиций не существует, хотя на те и на остальные накладываются ограничения, определяемые как качествами самих пептидных фрагментов, так и природой боковых радикалов, т.Е. Природой аминокислотных остатков.

К настоящему времени установлены последовательности аминокислот для нескольких тыщ разных белков. Запись структуры белков в виде развернутых структурных формул громоздка и не наглядна. Поэтому употребляется сокращенная форма записи – трехбуквенная либо однобуквенная (молекула вазопрессина):

Cys – Tyr – Phe – Gln – Asn – Cys – Pro – Arg – Gly – NH2 CYFQNCPRG – NH2

S S

При записи аминокислотной последовательности в полипептидных либо олигопептидных цепях с помощью сокращенной символики предполагается, если это особо не оговорено, что a-аминогруппа находится слева, а a-карбоксильная группа – справа. Соответствующие участки полипептидной цепи называют N-концом (аминным концом) и С-концом (карбоксильным концом), а аминокислотные остатки – соответственно N-концевым и С-концевым остатками.

4.2. Вторичная структура.

Фрагменты пространственной структуры биополимер, имеющие периодическое строение полимерного остова, разглядывают как элементы вторичной структуры.

Если на протяжении некого участка цепи однотипные углы, о которых говорилось на стр.15, Приблизительно одинаковы, то структура полипептидной цепи приобретает периодический характер. Существует два класса таковых структур – спиральные и растянутые (плоские либо складчатые).

Спиральной считается структура, у которой все однотипные атомы лежат на одной винтовой полосы. При этом спираль считается правой, если при наблюдении вдоль оси спирали она удаляется от наблюдающего по часовой стрелке, и левой – если удаляется против часовой стрелки. Полипептидная цепь имеет спиральную конформацию, если все атомы Ca находятся на одной винтовой полосы, все карбонильные атомы Ck - на другой, все атомы N – на третьей, причем шаг спирали для всех трех групп атомов обязан быть одинаков. Одинаковым обязано быть и число атомов, приходящихся на один виток спирали, независимо от того, идет ли речь об атомах Ck, Ca либо N. Расстояние же до общей винтовой полосы для каждого из этих трех типов атомов свое.

Главными элементами вторичной структуры белков являются a-спирали и b-складки.

Спиральные структуры белка. Для полипептидных цепей понятно несколько разных типов спиралей. Посреди них более распространена правая a-спираль. Идеальная a-спираль имеет шаг 0,54 нм и число однотипных атомов на один виток спирали 3,6, что значит полную периодичность на пяти витках спирали через каждые 18 аминокислотных остатков. Значения торсионных углов для идеальной a-спирали j = – 57° y = – 47 ° , а расстояния от атомов, образующих полипептидную цепь, до оси спирали составляет для N 0,15 нм, для C a 0,23 нм, для C k 0,17 нм. Неважно какая конформация существует при условии, что имеются причины, стабилизирующие её. В случае a-спирали таковыми факторами являются водородные связи, образуемые каждым карбонильным атомом (i+4)-го фрагмента. Принципиальным фактором стабилизации a-спирали также является параллельная ориентация дипольных моментов пептидных связей.

Складчатые структуры белка. Одним из распространенных примеров складчатой периодической структуры белка являются т.Н. b-складки, состоящие из двух фрагментов, каждый из которых представлен полипептидом.

b-складки также стабилизируются водородными связями меж атомом водорода аминной группы одного фрагмента и атомом кислорода карбоксильной группы другого фрагмента. При этом фрагменты могут иметь как параллельную, так и антипараллельную ориентацию относительно друг друга.

Структура, образующаяся в итоге таковых взаимодействий, представляет собой гофрированную структуру. Это сказывается на значениях торсионных углов j и y. Если в плоской, полностью растянутой структуре они обязаны были бы составить 180°, то в настоящих b-слоях они имеют значения j = – 119° и y = + 113°. Для того чтоб два участка полипептидной цепи размещались в ориентации, благоприятствующей образованию b-складок, меж ними обязан существовать участок, имеющий структуру, резко отличающийся от периодической.

4.2.1. причины, влияющие на образование вторичной структуры.

Структура определенного участка полипептидной цепи значительно зависит от структуры молекулы в целом. Причины, влияющие на формирование участков с определенной вторичной структурой, очень многообразны и далеко не во всех вариантах полностью выявлены. Понятно, что ряд аминокислотных остатков предпочтительно встречается в a-спиральных фрагментах, ряд остальных – в b-складках, некие аминокислоты – в большей степени в участках, лишенных периодической структуры. Вторичная структура в значимой степени определяется первичной структурой. В неких вариантах физический смысл таковой зависимости может быть понят из стереохимического анализа пространственной структуры. К примеру, как видно из рисунка в a-спирали сближены не лишь боковые радикалы соседних вдоль цепи аминокислотных остатков, но и некие пары остатков, находящихся на соседних витках спирали, в первую очередь каждый (i+1)-й остаток с (i+4)-м и с (i+5)-м. Поэтому в положениях (i+1) и (i+2), (i+1) и (i+4), (i+1) и (i+5) a-спиралей редко сразу встречается два больших радикала, таковых, к примеру, как боковые радикалы тирозина, триптофана, изолейцина. Еще менее совместимо со структурой спирали одновременное наличие трех больших остатков в положениях (i+1), (i+2) и (i+5) либо (i+1), (i+4) и (i+5). Поэтому такие композиции аминокислот в a-спиральных фрагментах являются редким исключением.

4.3. Третичная структура

Под этим термином соображают полную укладку в простанстве всей полипептидной цепи, включая укладку боковых радикалов. Полное представление о третичной структуре дают координаты всех атомов белка. Благодаря большущим фуррором рентгеноструктурного анализа такие данные, за исключением координат атомов водорода получены для значимого числа белков. Это большие массивы информации, хранящиеся в особых банках данных на машиночитаемых носителях, и их обработка немыслима без внедрения быстродействующих компьютеров. Полученные на компьютерах координаты атомов дают полную информацию о геометрии полипептидной цепи, в том числе значения торсионных углов, что дозволяет выявить спиральную структуру, b-складки либо нерегулярные фрагменты. Примером такового исследовательского подхода может служить следующая пространственная модель структуры фермента фосфоглицераткиназы:

общественная схема строения фосфоглицераткиназы. Для наглядности a-спиральные участки представлены в виде цилиндров, а b-складки – в виде лент со стрелкой, указывающей направление цепи от N-конца к С-концу. Полосы – нерегулярные участки, соединяющие структурированные фрагменты.

Изображение полной структуры даже маленький белковой молекулы на плоскости, будь то страничка книги либо экран монитора не достаточно информативно из-за очень сложного строения объекта. Чтоб исследователь мог наглядно представлять простанственное строение молекул сложных веществ, употребляют способы трехмерной компьютерной графики, позволяющей выводить на экран отдельные части молекул и манипулировать с ними, в частности поворачивать их в подходящих ракурсах.

Третичная структура формируется в итоге нековалентных взаимодействий (электростатические, ионные, силы Ван-дер-Ваальса и др.) Боковых радикалов, обрамляющих a-спирали и b-складки, и непериодических фрагментов полипептидной цепи. Посреди связей, удерживающих третичную структуру следует отметить:

а) дисульфидный мостик ( – S – S – )

б) сложноэфирный мостик (меж карбоксильной группой и гидроксильной группой)

в) солевой мостик (меж карбоксильной группой и аминогруппой)

г) водородные связи.

В согласовании с формой белковой молекулы, обусловленной третичной структурой, выделяют следующие группы белков:

1) Глобулярные белки. Пространственная структура этих белков в грубом приближении может быть представлена в виде шара либо не очень вытянутого эллипсоида - глобулы. Как правило, значимая часть полипептидной цепи таковых белков сформировывает a-спирали и b-складки. Соотношение меж ними может быть самым разным. К примеру, у миоглобина (подробнее о нем на стр.28) Имеется 5 a-спиральных частей и нет ни одной b-складки. У иммуноглобулинов (подробнее на стр.42), Напротив, основными элементами вторичной структуры являются b-складки, а a-спирали вообще отсутствуют. В вышеприведенной структуре фосфоглицераткиназы и те и остальные типы структур представлены приблизительно одинаково. В неких вариантах, как это видно на примере фосфоглицераткиназы, отчетливо просматриваются две либо более верно разделеннные в пространстве (но тем не менее, естественно, связанные пептидными мостиками) части – домены. Часто разные функциональные зоны белка разнесены по различным доменам.

2) Фибриллярные белки. Эти белки имеют вытянутую нитевидную форму, они выполняют в организме структурную функцию. В первичной структуре они имеют повторяющиеся участки и сформировывают довольно монотипную для всей полипептидной цепи вторичнкю структуру. Так, белок a-креатин (основной белковый компонент ногтей, волос, кожи) построен из протяженных a-спиралей. Фиброин шелка состоит из периодически повторяющихся фрагментов Gly – Ala – Gly – Ser , образующими b-складки. Есть менее распростаненные элементы вторичной структуры, пример – полипептидные цепи коллагена, образующие левые спирали с параметрами, резко отличающимися от характеристик a-спиралей. В коллагеновых волокнах три спиральные полипептидные цепи скручены в единую правую суперспираль:

Четвертичная структура

В большинстве случаев для функционирования белков нужно, чтоб несколько полимерных цепей были объединены в единый комплекс. Таковой комплекс также рассматривается как белок, состоящий из нескольких субъединиц. Субъединичная структура частенько фигурирует в научной литературе как четвертичная структура.

Белки, состоящие из нескольких субъединиц, обширно распространены в природе. Классический пример – четвертичная структура гемоглобина (подробнее – стр.26). Субъединицы принято обозначать греческими знаками. У гемоглобина имеется по две a и b субъединицы. Наличие нескольких субъединиц принципиально в функциональном отношении – это увеличивает степень насыщения кислородом. Четвертичную структуру гемоглобина обозначают как a2b2.

Субъединичное строение свойственно многим ферментам, в первую очередь тем, которые выполняют сложные функции. К примеру, РНК-полимераза из E.coli имеет субъединичную структуру a2bb’s, т.Е. Построен из четырех разнотипных субъединиц, причем b-субъединица продублирована. Этот белок выполняет сложные и разнообразные функции – инициирует ДНК, связывает субстраты – рибонуклеозидтрифосфаты, а также переносит нуклеотидные остатки на растущую полирибонуклеотидную цепь и некие остальные функции.

Работа многих белков подвержена т.Н. Аллостерической регуляции – особые соединения (эффекторы) “выключают” либо “включают” работу активного центра фермента. Такие ферменты имеют особые участки опознавания эффектора. И даже есть особые регуляторные субъединицы, в состав которых в том числе входят указанные участки. Классический пример – ферменты протеинкиназы, катализирующие перенос остатка фосфорной к-ты от молекулы АТФ на белки-субстраты.

Глава 5. характеристики

Белки имеют высшую молекулярную массу, некие растворимы в воде, способны к набуханию, характеризуются оптической активностью, подвижностью в электрическом поле и некоторыми другими качествами.

Белки активно вступают в химические реакции. Это свойство связано с тем, что аминокислоты, входящие в состав белков, содержат различные функциональные группы, способные реагировать с другими веществами. Принципиально, что такие взаимодействия происходят и внутри белковой молекулы, в итоге чего появляется пептидная, водородная дисульфидная и остальные виды связей. К радикалам аминокислот, а следовательно и белков, могут присоединяться разные соединения и ионы, что обеспечивает их транспорт по крови.

Белки являются высокомолекулярными соединениями. Это полимеры, состоящие из сотен и тыщ аминокислотных остатков – мономеров. Соответственно и молекулярная масса белков находится в пределах 10 000 – 1 000 000. Так, в составе рибонуклеазы (фермента, расщепляющего РНК) содержится 124 аминокислотных остатка и её молекулярная масса составляет приблизительно 14 000. Миоглобин (белок мускул), состоящий из 153 аминокислотных остатков, имеет молекулярную массу 17 000, а гемоглобин – 64 500 (574 аминокислотных остатка). Молекулярные массы остальных белков более высокие: g-глобулин ( образует антитела) состоит из 1250 аминокислот и имеет молекулярную массу около 150 000, а молекулярная масса фермента глутаматдегидрогеназы превосходит 1 000 000.

Определение молекулярной массы проводится различными способами: осмометрическим, гельфильтрационным, оптическим и др. Но более чётким является способ седиментации, предложенный Т. Сведбергом. Он основан на том, что при ультрацентрифугировании ускорением до 900 000 g скорость осаждения белков зависит от их молекулярной массы.

Важнейшим свойством белков является их способность проявлять как кислые так и главные, то есть выступать в роли амфотерных электролитов. Это обеспечивается за счет разных диссоциирующих группировок, входящих в состав радикалов аминокислот. К примеру, кислотные характеристики белку придают карбоксильные группы аспарагиновой глутаминовой аминокислот, а щелочные – радикалы аргинина, лизина и гистидина. Чем больше дикарбоновых аминокислот содержится в белке, тем сильнее появляются его кислотные характеристики и напротив.

Эти же группировки имеют и электрические заряды, формирующие общий заряд белковой молекулы. В белках, где преобладают аспарагиновая и глутаминовая аминокислоты, заряд белка будет отрицательным, избыток главных аминокислот придает положительный заряд белковой молекуле. Вследствие этого в электрическом поле белки будут передвигаться к катоду либо аноду в зависимости от величины их общего заряда. Так, в щелочной среде (рН 7 – 14) белок отдает протон и заряжается отрицательно, тогда как в кислой среде (рН 1 – 7) подавляется диссоциация кислотных групп и белок становится катионом.

NH3+ Кислая среда NH3+ Щелочная среда NH2

R R R

COOH COO – COO –

Катион Амфион Анион

+H+ +H+

Белок Белок Белок

– H+ – H+

таковым образом, фактором, определяющим поведение белка как катиона либо аниона, является реакция среды, которая определяется концентрацией водородных ионов и выражается величиной рН. Но при определенных значениях рН число положительных и отрицательных зарядов уравнивается и молекула становится электронейтральной, т.Е. Она не будет передвигаться в электрическом поле. Такое значение рН среды определяется как изоэлектрическая точка белков. При этом белок находится в наименее устойчивом состоянии и при незначительных конфигурациях рН в кислую либо щелочную сторону просто выпадает в осадок. Для большинства природных белков изоэлектрическая точка находится в слабокислой среде (рН 4,8 – 5,4), что свидетельствует о преобладании в их составе дикарбоновых аминокислот.

Свойство амфотерности лежит в базе буферных параметров белков и их участии в регуляции рН крови. Величина рН крови человека различается постоянством и находится в пределах 7,36 – 7,4 , несмотря на разные вещества кислого либо основного характера, регулярно поступающие с пищей либо образующиеся в обменных действиях – следовательно есть особые механизмы регуляции кислотно-щелочного равновесия внутренней среды организма. К таковым системам относится рассматриваемая в гл. “ Классификация” гемоглобиновая буферная система (стр.28). Изменение рН крови более чем на 0,07 свидетельствует о развитии патологического процесса. Сдвиг рН в кислую сторону именуется ацидозом, а в щелочную – алкалозом.

принципиальное значение для организма имеет способность белков адсорбироватьь на собственной поверхности некие вещества и ионы (гормоны, витамины, железо, медь), которые или плохо растворимы в воде, или являются токсичными ( билирубин, свободные жирные кислоты). Белки транспортируют их по крови к местам дальнейших перевоплощений либо обезвреживания.

Водные растворы белков имеют свои особенности. Во-первых, белки владеют огромным сродством к воде, т.Е. Они гидрофильны. Это означает, что молекулы белка, как заряженные частицы, притягивают к себе диполи воды, которые размещаются вокруг белковой молекулы и образуют водную либо гидратную оболочку. Эта оболочка предохраняет молекулы белка от склеивания и выпадения в осадок. Величина гидратной оболочки зависит от структуры белка. К примеру, альбумины более просто связываются с молекулами воды и имеют относительно огромную водную оболочку, тогда как глобулины, фибриноген присоединяют воду ужаснее, и гидратная оболочка и них меньше. Таковым образом, устойчивость аква раствора белка определяется двумя факторами: наличием заряда белковой молекулы и находящейся вокруг нее аква оболочки. При удалении этих факторов белок выпадает в осадок. Данный процесс может быть обратимым и необратимым.

Обратимое осаждение белков (высаливание) предполагает выпадение белка в осадок под действием определенных веществ, после удаления которых он вновь возвращается в свое исходное (нативное) состояние. Для высаливания белков употребляют соли щелочных и щелочноземельных металлов (более частенько в практике употребляют сульфат натрия и аммония). Эти соли убирают водную оболочку (вызывают обезвоживание) и снимают заряд. Меж величиной аква оболочки белковых молекул и концентрацией солей существует ровная зависимость: чем меньше гидратная оболочка, тем меньше требуется солей. Так, глобулины, имеющие крупные и тяжелые молекулы и небольшую водную оболочку, выпадают в осадок при неполном насыщении раствора солями, а альбумины как более маленькие молекулы, окруженные большой аква оболочкой, – при полном насыщении.

Нативная молекула белка

Денатурированная молекула белка. Черточки обозначают связи в молекуле нативного белка, разрывающиеся при денатурации

Необратимое осаждение связано с глубокими внутримолекулярными переменами структуры белка, что приводит в потере ими нативных параметров (растворимости, биологической активности и др.). Таковой белок именуется денатурированным, а процесс денатурацией. Денатурация белков происходит в желудке, где имеется сильнокислая среда (рН 0,5 – 1,5), и это способствует расщеплению белков протеолитическими ферментами. Денатурация белков положена в базу исцеления отравления тяжелыми сплавами, когда больному вводят per os (“через рот”) молоко либо сырые яйца с тем, чтоб сплавы денатурируя белки молока либо яиц. Адсорбировались на их поверхности и не действовали на белки слизистой оболочки желудка и кишечника, а также не всасывались

в кровь.

Размер белковых молекул лежит в пределах 1 мкм до 1 нм и, следовательно, они являются коллоидными частицами, которые в воде образуют коллоидные растворы. Эти растворы характеризуются высокой вязкостью, способностью рассеивать лучи видимого света, не проходят через полупроницаемые мембраны.

Вязкость раствора зависит от молекулярной массы и концентрации растворенного вещества. Чем выше молекулярная масса, тем раствор более вязкий. Белки как высокомолекулярные соединения образуют вязкие растворы. К примеру, раствор яичного белка в воде.

Вода

Коллоидные частицы не проходят через полупроницаемые мембраны (целлофан, коллоидную пленку), так как их поры меньше коллоидных частиц. Непроницаемыми для белка являются все биологические мембраны. Это свойство белковых растворов обширно употребляется в медицине и химии для очистки белковых препаратов от посторонних примесей. Таковой процесс разделения именуется диализом. Явление диализа лежит в базе деяния аппарата “искусственная почка”, который обширно употребляется в медицине для исцеления острой почечной недостаточности.

Диализ (белые крупные кружки – молекулы белка, темные – молекулы хлористого натрия)

Глава 6. Классификация белков

Все белки в зависимости от строения делятся на обыкновенные – протеины, состоящие лишь из аминокислот, и сложные - протеиды, имеющих небелковую протеистическую группу.

6.1. Протеины

Протеины представляют собой обыкновенные белки, состоящие лишь из белковой части. Они обширно распространены в животном и растительном мире. К ним относятся альбумины и глобулины, встречающиеся фактически во всех животных и растительных клеточках, биологических жидкостях и выполняющих принципиальные биологические функции. Альбумины участвуют в поддержании осмотического давления крови (создают онкотическое давление), транспортируют с кровью разные вещества. Глобулины входят в состав ферментов, составляющих базу иммуноглобулинов, выполняющих функции антител. В сыворотке крови меж этими двумя компонентами существует неизменное соотношение – альбумино-глобулиновый коэффициент (А/Г), равный 1,7 – 2,3 и имеющий принципиальное диагностическое значение.

Другими представителями протеинов являются протамины и гистоны – белки основного характера, содержащие много лизина и аргинина. Эти белки входят в состав нуклеопротеидов. Другой основной белок – коллаген – образует внеклеточное вещество соединительной ткани и находится в коже, хрящах и др. Тканях.

6.2. Протеиды

Протеиды являются сложными белками, состоящими из белковой и небелковой частей. Заглавие протеида определяется заглавием его простетической группы). Так, нуклеиновые кислоты являются небелковой частью нуклеопротеидов, фосфорная к-та входит в состав фосфопротеидов, углеводы – гликопротеидов, а липиды – липопротеидов.

Нуклеопротеиды. Имеют принципиальное значение, т.К. Их небелковая часть представлена ДНК и РНК. Простетическая группа представлена в основном гистонами и протаминами. Такие комплексы ДНК с гистонами обнаружены в сперматозоидах, а с гистонами – в соматических клеточках, где молекула ДНК “намотана” вокруг молекул гистонов. Нуклепротеидами по собственной природе являются вне клеточки вирусы – это комплексы вирусной нуклеиновой к-ты и белковой оболочки – капсида.

Хромопротеиды. Являются сложными белками, простетическая группа которых представлена окрашенными соединениями. К хромопротеидам относятся гемоглобин, миоглобин (бело мускул), ряд ферментов (каталаза, пероксидаза, цитохромы), а также хлорофилл.

Гемоглобин (Hb) состоит из белка глобина и небелковой части гема, включающего атом Fe(II), соединенный с протопорфирином. Молекула гемоглобина состоит из 4-х субъединиц: двух a и двух b и соответственно содержит четыре полипептидные цепочки двух видов. Любая a-цепочка содержит 141, а b-цепочка – 146 аминокислотных остатков.

Атом железа может образовать шесть координационных связей. Четыре связи ориентированы к атомам азота пиррольных колец, оставшееся две связи – перпендикулярно к плоскости порфиринового кольца по обе его стороны. Гемы расположены вблизи поверхности белковой глобулы в особых карманах, образованных складками полипептидных цепочек глобина. Гемоглобин при обычном функционировании может находиться в одной из трех форм: феррогемоглобин (традиционно называемый дезоксигемоглобином либо просто гемоглобином), оксигемоглобин и ферригемоглобин (метгемоглобин). В ферригемоглобине железо находится в закисной форме Fe(II), одна из двух связей, перпендикулярных к плоскости порфиринового кольца, ориентирована к атому азота гистидинового остатка, называемого проксимальным (соседним), по другую сторону порфиринового кольца и на большем расстоянии от него находится другой гистидиновый остаток – дистальный гистидин, не связанный конкретно с атомом железа. Взаимодействие молекулярного кислорода со свободным гемом приводит к необратимому окислению атома железа гема [Fe(II) Þ Fe(III); гем Þ гемин]. Поэтому в дезоксигемоглобине глобин предохраняет железо от окисления.

| |

CH2 CH2

| |

H2C CH H2C CH O

C C

N

N

N Fe N+ ¾ Fe ¾ O

H CH H CH

Плоскость порфиринового кольца

Плоскость порфиринового кольца

При содействии молекулярного кислорода с гемоглобином существует маленькая, но конечная возможность окисления последнего: молекула O2 не присоединяется, но окислит железо: Fe2+ + O2 Þ Fe3+ + O2–. Поэтому при дыхании в эритроцитах непрерывно появляется метгемоглобин. Для его восстановления в эритроците существует особая ферментативная система, восстанавливающая метгемоглобин и превращающая его в обычный дезоксигемоглобин. При нарушении данной системы возникает тяжелое заболевание – метгемоглобинемия, при которой гемоглобин перестает быть переносчиком кислорода.

Присоединение кислорода меняет кислотно-главные характеристики гемоглобина. Оксигемоглоин является более сильной кислотой, чем дезоксигемоглобин. Поэтому в тканях, где значимая часть гемоглобина теряет кислород и становится более мощным основанием, гемоглобин связывает образующуюся в ходе метаболических внутриклеточных действий углекислоту. В альвеолах легких дезоксигемоглобин опять преобразуется в оксигемоглобин, становится более сильной кислотой и способствует отщеплению CO2. Углекислота, освобождаемая тканями, недостаточно отлично растворима для эффективного переноса. С помощью фермента карбоангидразы, ускоряющего прямую и обратную реакцию:

CO2 + H2O Û HCO3 – + H+,

Двуокись углерода преобразуется в отлично растворимый бикарбонат-анион. В капиллярах тканей отщепление кислорода увеличивает содержание дезоксигемоглобина, связывающего протоны и смещающего равновесие реакции вправо. Просто растворимый ион бикарбоната переносится кровью. В альвеолах легких гемоглобин оксигенируется, протоны освобождаются и равновесие смещается влево. Появляется плохо растворимая двуокись углерода CO2, которая удаляется из аква фазы и выдыхается. Таковым образом, гемоглобин работает как буфер с переменным значением pH. Функция гемоглобина как переносчика углекислоты не менее принципиальна, чем его функция переноса кислорода.

Миоглобин. Хромопротеид, содержащийся в мышцах. Он состоит лишь из одной цепи, аналогичной субъединице гемоглобина. Миоглобин является дыхательным пигментом мышечной ткани. Он существенно легче гемоглобина связывается с кислородом, но труднее отдает его. Миоглобин создает запасы кислорода в мышцах, где его количество может достичь 14% всего кислорода организма. Это имеет принципиальное значение, в особенности для работы мускул сердца. Высокое содержание миоглобина найдено у морских млекопитающих (тюленя, моржа), что дозволяет им долгое время находиться под водой.

Гликопротеиды. Представляют собой сложные белки простетическая группа которых образована производными углеводов (аминосахарами, гексуроновыми кислотами). Гликопротеиды входят в состав клеточных мембран. Так, легочные стены микробов построены из пептидогликанов, являющихся производными линейных полисахаридов, несущих ковалентно связанные с ними пептидные фрагменты. Эти фрагменты осуществляют сшивание полисахаридных цепей с образованием механически прочной сетчатой структуры. К примеру, клеточная стена E.coli построена из полисахаридных цепей, образованных остатками N-ацетилглюкозамина, связанными b-(1®4)связями, причем каждый второй остаток несет присоединенный к нему по атому С3 фрагмент, образованный связанными амидными связями остатками молочной кислоты, L-аланина, D-глутамата (через g-карбоксил), мезодиаминонимелината и D-аланина:

O O

OH

O O O

O

CH NHCOCH3 NHCOCH3

H3C CO – L-Ala – D-Glu – NH – CHCH2CH2CH2CHCO – D-Ala(CO) –

| |

COO – NH

|

любая С-концевая группа этого пептида, принадлежащая остатку D-аланина, образует амидную связь с аминогруппой остатка диаминонимиелиновой кислоты, принадлежащей соседней полисахаридной цепи.

не считая вышеприведенной функции гликопротеиды участвуют в транспорте разных веществ, в действиях свертывания крови, иммунитета, являются составными частями слизи и секретов желудочно-кишечного тракта. У арктических рыб гликопротеиды играются роль антифризов – веществ, препятствующих образованию кристаллов льда внутри их организма.

Фосфопротеиды. Имеют в качестве небелкового компонента фосфорную к-ту. Представителями данных белков являются казеиноген молока, вителлин (белок желтков яиц), ихтулин (белок икры рыб). таковая локализация фосфопротеидов свидетельствует о принципиальном их значении для развивающегося организма. У взрослых форм эти белки находятся в костной и нервной тканях.

Липопротеиды. Сложные белки, простетическая группа которых образована липидами. По строению это маленького размера (150-200 нм) сферические частицы, наружная оболочка которых образована белками (что дозволяет им передвигаться по крови), а внутренняя часть – липидами и их производными. Основная функция липопротеидов – транспорт по крови липидов. В зависимости от количества белка и липидов, липопротеиды разделяются на хиломикроны, липопротеиды низкой плотности (ЛПНП) и высокой плотности (ЛПВП), которые время от времени обозначаются как a- и b-липопротеиды.

Хиломикроны являются более крупными из липопротеидов и содержат до 98-99% липидов и лишь 1-2% белка. Они образуются в слизистой оболочки кишечника и обеспечивают транспорт липидов из кишечника в лимфу, а потом в кровь.

В ЛПНП количество белка составляет 9-20% , а посреди липидов преобладают холестерин и триацилглицерины (до 40%). Белковая часть ЛПВП колеблется в пределах 35-50%, а белковая представлена фосфолипидами и холестерином. Таковым образом, холестерин транспортируется по крови в составе липопротеидов, в особенности ЛПНП.

Глава 7. способы исследования белков

посреди способов, используемых в биохимии, ключевое значение имеют выделение веществ из биологических источников и, как правило, их очистка с целью получения личных соединений.

Следует отметить три главные трудности выделения в личном виде компонентов из живых организмов:

1) Исходный материал - биомасса состоит из многих сотен и даже тыщ разных соединений. Разделение таковых смесей очень трудно, не считая того многие составляющие этих смесей построены достаточно однотипно (к примеру, иммуноглобулины). В связи с этим они не достаточно различаются меж собой по физико-химическим чертам - растворимости либо способности к сорбции на определенном типе сорбента.

2) Работа с биохимическими объектами часто сопровождается необходимостью манипулировать с совсем небольшими количествами исходного вещества. При ничтожно малом количестве используемого материала способы их детекции обязаны быть высокочувствительными. Таковыми способами являются спектрофотометрические способы, основанные на измерении поглощения видимого либо ультрафиолетового света, радиохимические способы, основанные на изменении радиоактивности, и люминесцентные, основанные на изменении флуоресценции, био- и хемилюминесценции.

3) Многие составляющие владеют совсем низкой устойчивостью. Частенько задачка состоит в том, чтоб выделить белок в нативном, т.Е. Сохраняющим биологическую активность состоянии. Меж тем многие белки при умеренных температурах и незначительных конфигурациях рН среды подвержены денатурации, которая традиционно сопровождается потерей биологической активности - инактивацией. Не считая того, в клеточках частенько имеются ферменты (в неповрежденных клеточках в лизосомах) способные повредить те либо другие вещества, в первую очередь белки.

7.1. Традиционные способы выделения и очистки белков

Все способы разделения смесей основаны на том, что разделяемые составляющие в итоге каких-или манипуляций оказываются в различных участках системы и могут быть механически разделены друг от друга.

Выделение личных белков является ступенчатым действием, т.К. На первых этапах очистки фракции содержат множество примесей. На каждой ступени разделения обязана получаться фракция, более богатая нужным веществом, чем предшествующая. Таковой процесс частенько называют фракционированием.

На каждой стадии разделения белок находится или в виде раствора, или в виде осадка.

1) Осаждение. Для осаждения нужно снизить каким-или методом растворимость белка. Как уже говорилось в гл.5, Стр.22 Растворимость белка зависит от их способности к гидратации. У глобулярных водорастворимых белков высокий уровень гидратации обеспечивается расположением гидрофильных групп на поверхности. Добавление органических растворителей понижает степень гидратации и приводит к осаждению белка. В качестве таковых растворителей употребляют ацетон. Осаждают белки также с помощью солей, к примеру, сульфата аммония. Принцип этого способа основан на том, что при повышении концентрации соли в растворе происходит сжатие ионных атмосфер, образуемых противоионами белка, что способствует сближению их до критического расстояния, на котором межмолекулярные силы ван-дер-ваальсова притяжения перевешивают кулоновские силы отталкивания противоионов. Это приводит к слипанию белковых частиц и их выпадению в осадок.

2) Изоэлектрическое осаждение. Заряд белков обусловлен в первую очередь остатками аспаратата и глутамата (отрицательный заряд) и остатками лизина и аргинина (положительный заряд). По мере повышения рН различными методами заряд белков проходит от положительных к отрицательным значениям и в изоэлектрической точке оказывается равен нулю. В итоге белок лишается собственной ионной атмосферы и его частицы слипаются, выпадая в осадок.

3) Центрифугирование. Выпавший осадок белка можно выделить фильтрованием. Для этого частенько пользуются центрифугами. Частицы осажденного вещества под действием центробежной силы оседают на дне центрифужных стаканов и сжимаются в плотный осадок, с которого оставшийся раствор (надосадочная жидкость, либо супернатант) просто соединяется либо отсасывается. Скоростные центрифуги (ультрацентрифуги) создают центробежное ускорение порядка 105g (т.Е. 105 Ускорений свободного падения), что дозволяет осаждать даже некие крупные надмолекулярные агрегаты - рибосомы и вирусы.

4) Сорбция. базирована на различном сродстве компонентов смесей к определенным веществам - сорбентам. Более частенько используемый сорбент - гель фосфата кальция (гидроксиапатит) либо активированный уголь. Эффективную сорбцию можно получить на ионитах- сорбентах, имеющих на поверхности заряженные группы. В исходном состоянии эти заряды скомпенсированы какими-или подвижными противоионами. Фактически при сорбции на ионитах происходит обмен этих противоионов. Если на поверхности сорбента находятся отрицательно заряженные группы, то он связывает катионы и его называют катионитом, соответственно сорбент с положительно заряженными группами называют анионитом. В качестве ионитов почаще всего употребляют материалы (после соответствующей химической обработки) на гидрофильной базе - целлюлозе, декстране, силикагеле либо пористых стеклах.

5) Ситовой эффект. Молекулярные сита представляют собой материалы с совсем малеханькими порами определенного размера. Следует отметить различие этих “сит”: крупные частицы не остаются на поверхности материала сита, а обтекают его частички (гранулы), тогда как маленькие вещества примесей диффундируют в частицы сита и таковым образом задерживаются. Материалом для молекулярных сит может служить сефадекс (полисахарид декстран, у которого после соответствующей обработки цепи оказываются сшитыми трехуглеродными мостиками) либо полиакриламид, линейные цепи которого сшиты метиленовыми мостиками.

В перечисленных способах в конечной смеси остаются вспомогательные низкомолекулярные вещества - органические растворители, соли и кислоты. Для очищения от них употребляется способ диализа, упоминавшийся в главе “Свойства белков”. Диализ основан на применении мембран проницаемых для воды и низкомолекулярных веществ и непроницаемых для белков. Почаще всего с данной целью употребляют пленки из целлофана (нитрат целлюлозы). В лаборатории подлежащий диализу раствор белка помещают в мешок из целлофана и погружаю последний в сосуд с водой. Непрерывный ток воды через сосуд приводит к полному переходу в него всех проходящих через целлофан веществ, а белки остаются внутри (см. Иллюстрацию к гл.5).

7.2. способы зонального разделения

Эти способы основаны на том, что создается некая система, в которой составляющие смеси передвигаются с различными скоростями. Если в такую систему ввести разделяемую смесь в виде некой зоны, то по мере её перемещения составляющие смеси, движущиеся с различными скоростями, будут сформировывать отдельные зоны, которые потом можно разнести в различные приемники.

1) Хроматография. При разделении белков и их анализе употребляется жидкостная хроматография. В жидкостной хроматографии зона разделяемых веществ с помощью тока элюирующей (вымывающей) воды перемещается относительно неподвижной фазы, которая владеет различным сродством к разделяемым компонентам. При перемещении зоны с помощью тока элюента каждый из разделяемых компонентов проводит некоторую часть времени на неподвижной фазе. Чем больше это время, тем медленнее перемещается зона с разделяемой смесью.

В зависимости от природы физико-химического явления, лежащего в базе разделения веществ, различают адсорбционную, ионообменную, распределительную и гель-хроматографию (эксклюзивную хроматографию). В адсорбционной почаще всего употребляют оксид алюминия в качестве неподвижной фазы. В ионообменной употребляются те же типы ионитов, что в ионообменной сорбции. Распределительная хроматогрфия базирована на разделении веществ меж двумя несмешивающимися жидкими фазами. Неподвижная жидкая фаза появляется в итоге её закрепления на пористом нерастворимом носителе. В гель

2) Электрофорез. В этом случае зоны создаются в итоге того, что различные составляющие смеси с различной скоростью передвигаются в электрическом поле. После специальной обработки разделяемые смеси наносят на гель (декстроновый, полиакриламидный, либо другой) а потом подключают но определенное время неизменный электрический ток. Белки в зависимости от собственной молекулярной массы и заряда начинают двигаться с различной скоростью. После отключения тока гель помещают в особый раствор, где интересующие исследователя белки окрашиваются. Существует электрофорез в растворе, но он имеет ограниченное применение, т.К. Исследуемые белки частенько подвергаются значительному диффузионному размыванию. Но сейчас стало вероятным использовать этот способ в условиях невесомости в космосе, что избавляет конвекционные токи, обуславливающие диффузионную размывку.

Все описанные выше способы зонального разделения являются одномерными, разделение в них происходит в одной координате. Наряду с этим используются двумерные системы разделения на пластинках. При этом разделяемую смесь в виде пятна наносят на один из углов и разделяют в одном направлении. Потом какие-или характеристики, определяющие разделяющую способность системы изменяют и проводят разделение в перпендикулярном направлении. При успешном подборе системы и условий разделения удается поделить те составляющие, которые не разделились при первой процедуре. Композиции способов могут быть достаточно разнообразны: двумерная хроматография с внедрением в различных направлениях различных элюентов, хроматография в одном и электрофорез в другом направлениях.

7.3. Определение первичной структуры белков

Определение первичной структуры белков сводится к выяснению порядка расположения аминокислот в полипептидной цепочке. Эту задачку решают с помощью способа секвенирования (от англ. sequence - последовательность).

фактически секвенирование на его сегодняшнем уровне дозволяет найти аминокислотную последовательность а полипептидах, размер которых не превосходит несколько десятков аминокислотных остатков. В то же время исследуемые полипептидные фрагменты существенно короче тех природных белков, с которыми приходится иметь дело. Поэтому нужно предварительное разрезание исходного полипептида на короткие фрагменты. После секвенирования полученных фрагментов их нужно опять сшить в начальной последовательности.

таковым образом определение первичной последовательности белка сводится к следующим главным этапам:

1) Расщепление белка на несколько фрагментов длиной, доступной для секвенирования.

2) Секвенирование каждого из полученных фрагментов.

3) Сборка полной структуры белка из установленных структур его фрагментов.

Для специфического расщепления белков по определенным точкам используются как ферментативные, так и химические способы. Из ферментов, катализирующих гидролиз белков по определенным точкам, более обширно употребляют трипсин и химотрипсин. Трипсин катализирует гидролиз пептидных связей, расположенных после остатков лизина и аргинина. Химотрипсин в большей степени расщепляет белки после остатков ароматических аминокислот - фенилаланина, тирозина и триптофана. При необходимости специфичность трипсина может быть повышена либо изменена. К примеру, обработка цитраконовым ангидридом исследуемого белка приводит к ацилированию остатков лизина. В таком модифицированном белке расщепление будет проходить лишь по остаткам аргинина.

Наряду с ферментативными способами употребляются и химические способы расщепления белков. Для данной цели частенько используют бромциан, расщепляющий белок по остаткам метионина:

H+

Секвенирование проводят способом, известным как способ Эдмана. Последовательная обработка полипептида, имеющего свободную концевую a-аминогруппу, каким-или алкил- либо арилизотиоцианатом в слабощелочной среде приводит к образованию соответствующей тиомочевины, которая в равномерно кислой среде приводит (при значениях кислотности, не повреждающих пептидной связи) отщепляется в виде соответствующего тиогидантоина. Уникальная процедура Эдмана базирована на использовании фенилизотиоцианата и тем самым на образовании фенилтиогидантоинов:

В итоге появляется фенилтиогидантоин, содержащий боковой радикал аминокислоты R1, который может быть идентифицирован методом измерения какой-или физической либо физико-химической свойства, позволяющей различать гидантоины, соответствующие различным входящим в состав белков аминокислотам. В качестве таковой свойства может служить хроматографическая подвижность в какой-или предварительно проградуированной по обычным образцам гидантоинов системе либо молекулярная масса, определяемая с помощью масс-спектрометра.

перевоплощение N-концевого аминокислотного остатка в тиогидантоин приводит к укорочению анализируемой полипептидной цепи на одно звено. Выделив этот пептид, исследователь получает возможность повторить всю функцию, установить природу второго аминокислотного остатка и выделить полипептид, укороченный на два звена. Многократное повторение таковой ступенчатой деградации дает возможность последовательно идентифицировать все составляющие исходный полипептид остатки аминокислот, т.Е. Установить его первичную структуру. Фактически способ Эдмана дозволяет сделать один-два десятка шагов. Работа сводится к многократному повторению одних и тех же чередующихся процедур: добавления изотиоцианата, отщепления тиогидантоина, отделения его от укороченного пептида для последующей идентификации, выделение оставшегося полипептида в виде подходящем для следующего шага обработки. Чтоб избавить исследователей от таковой однотонной работы, требующей совместно с тем серьезного соблюдения условий опыта на каждом шаге, сделаны особые автоматизированные установки для проведения вех перечисленных операций - автоматические секвенаторы полипептидов. С их помощью удается произвести до 40 - 60 шагов ступенчатой деградации.

Завершающим этапом установления первичной структуры белка является восстановление порядка, в котором просеквенированные фрагменты размещались в исходном полипептиде. Почаще всего для данной цели исползуют подход изветный как способ перекрывающихся белков. Ниже излагается основная мысль способа.

Если установлена структура всех полипептидов, полученных расщеплением исследуемого белка с помощью трипсина (далее такие полипептиды обозначаются буквой Т - от слова “трипсиновые”), то остается найти для каждого из этих пептидов, с какими двумя Т-пептидами он соседствует с N- и С-конца. В структуре просеквенированных Т-пептидов таковая информация полностью отсутствует. Но её можно частично, а в ряде случаев и полностью вернуть, если располагать аналогичными данными для серии полипептидов, полученных расщеплением того же исследуемого белка по какой-или другой группе аминокислотных остатков. Для определенности ниже речь будет идти о полипептидах, полученных расщеплением химотрипсином (пептиды группы С, chymotryptic).

Как видно из рисунка, если два Т-пептида являются соседними в исходной цепи, то существует С-пептид, который или содержит в собственном составе полностью оба либо один из рассматриваемых Т-пептидов, или как минимум содержит С-концевую часть левого и N-концевую часть правого пептида группы Т. Этот С-пептид перекрывает два соседних Т-пептида, с чем и связано заглавие способа.

таковым образом, просматривая структуры пептидов Т и С, можно для хоть какой пары Т-пептидов выявить, являются ли они соседями в исследуемом белке либо разделены одним либо несколькими другими Т-пептидами. Неоднозначность может показаться лишь в том случае, если перекрываемый каким-или из С-петидов концевой фрагмент встречается у двух либо нескольких Т-пептидов. Возможность этого как правило невелика. Если это все же происходит, то используют более сложные способы комбинаторики.

Глава 8. Химический синтез полипептидов и белков

Химический синтез полипептидов и белков имеет огромное практическое и теоретическое значение. В практическом отношении важны белковые гормоны - инсулин и вазопрессин, в настоящее время получаемые синтетическим методом. Интересны и имеют практическое применение пептиды группы пептидов мозга: метионин-энкефалин (Tyr-Gly-Gly-Phe-Met) и лейцин-энкефалин (Tyr-Gly-Gly-Phe-Leu). Эти соединения оказывают на мозговые центры такое же действие, как и морфин. Таковым образом они могут применяться в качестве анальгетика, но они фактически не вызывают привыкания.

Традиционные способы синтеза регулярных полимеров разрешают получить сополимеры, состоящие из двух (либо более) сходных типов мономеров со статистическим распределением их по цепи, в том числе белков. В частности, может быть получение гомополимеров либо статистических сополимеров, состоящих из аминокислотных остатков, связанных пептидными связями (полиаминокислот).

В качестве примера можно привести процесс получения полиаминокислот, основанный на конденсации N-карбоксиангидридов аминокислот, образуемых из соответствующих аминокислот обработкой фосгеном:

Эти соединения содержат электрофильную ангидридную группу, которая может атаковать алифатическую аминогруппу аминокислоты, используемой в качестве затравки, с выделением СО2 и одновременном освобождением новой аминогруппы из атакующей молекулы N-карбоксиангидрида, таковым образом открывая возможность поликонденсации:

несложно заметить, что любая стадия поликонденсации (с учетом реакции образования N-карбоксиангидридов аминокислот) сопровождается перевоплощением молекулы COCl2 в CO2 и 2HCl, что термодинамически выгодно и является источником свободной энергии для образования пептидной связи.

При синтезе нерегулярных полипептидов базируются также на активации карбоксильных групп. Большая часть из них базируется на использовании N,N-дициклогексилкарбодиимида (ДЦК). Он способен в присутствии RCOO- и амина NH2R’ выполнить активацию карбоксильных групп:

Промежуточнам соединением является O-ацил-N,N’-дициклогексилмочевину (ДЦМ):

традиционно ДЦК в пептидном синтезе употребляется не конкретно, а для синтеза стабильных реакционноспособных производных аминокислот, ангидридов либо активированных эфиров методом реакции с соответствующими гидроксисоединениями:

Вследствие нуклеофильного характера, обязаны содержать мощный электронный акцептор Х.

NH2CHR1C(O)-NHCHR2C(O)-OX

Тем не менее эти соединения нельзя конкретно употреблять для синтеза пептидов определенной структуры. Смешивая две аминокислоты с активированными карбоксильными группами, можно получить четыре различных дипептида:

NH2CHR1C(O)-OX + NH2CHR1C(O)-OX

Более того из-за наличия активных групп процесс может идти дальше. Но в итоге выходит лишь статистический полимер.

NH2CHR1C(O)-NHCHR2CОО-

Для предотвращения образования лишних полипептидов нужно исключить роль в процессе аминогруппы первой аминокислоты и активированной аминогруппы второй (в итоге выходит пептид ). Это достигается внедрением защитных групп Z на тех функциональных группах, которые не обязаны вступать во взаимодействие. Реакция

обязана приводить к одному определенному дипипептиду. Этот пептид нереакционноспособен и для продолжения процесса нужно удалить одну из защитных групп Z1,Z2, для того чтоб открыть или NH2, или СООН-группу для следующей стадии удлинения пептидной цепи. Поэтому основным требованием к защитным группам является возможность их мягкого селективного удаления, не повреждающего пептидную связь. Более обширно для защиты a-аминогрупп употребляется трет-бутилоксикарбонильная группа (Вос), которую просто ввести в аминогруппу обработкой аминокислоты подходящим N-гидроксисукциниимидным эфиром:

+H+

Эту группу просто удалить слабой кислотной обработкой пептида, при которой эта связь не разрушается:

+ NH2CHR1C(O)-NHCHR2C(O)-Z2

В качестве группы Z2 употребляют эфирные группы, которые стабильны в кислой среде в условиях проведения синтеза и могут быть селективно удалены мягкой щелочной обработкой.

специфичной особенностью полипептидного синтеза является большущее число идентичных стадий, которые нужно проводить на каждом этапе: образование новой пептидной связи, удаление защитной группы для подготовки к следующей стадии элонгации (удлинения) цепи и промежуточные отмывки от избытка реагентов и побочных товаров после каждого химического перевоплощения. Способ, разработанный Р.Меррифилдом, дал возможность автоматизировать этот процесс и понизить механические утраты. Согласно этому способу, первый мономер во вновь строящейся цепи синтезируемого полипептида ковалентно связывается с нерастворимым носителем (смолой - сополимер стиролдивинилбензола) и все следующие стадии проводятся с полипептидом, возрастающим на данной смоле. Этот способ известен как твердофазный синтез полипептидов. К смоле попеременно добавляют еще один синтон (мономер, содержащий набор защитных групп и в ряде случаев активированные остатки) и реагент для удаления концевой защитной группы (традиционно в остаток). Химические стадии сопровождаются соответствующими промывками. В течение всего процесса пептид остается связанным со смолой. Поместив в колонку смолу, с которой связан синтезируемый полипептид, можно просто автоматизировать процесс, запрограммировав смену потоков через колонку: синтон (мономер) - растворитель - смесь для удаления защиты - растворитель и т.Д. Разработаны особые приборы для автоматизированного полипептидного синтеза. Применение такового устройства дозволяет получить такие сложные полипептиды, как 99-членный полипептид - протеазу, кодированную ВИЧ-1. Эта протеаза нужна для протеолитического разрезания огромных полипептидов, образовавшихся при трансляции (белковом синтезе) вирусных и-РНК. Большой энтузиазм к данной протеазе обусловлен надеждой отыскать специальные ингибиторы замедляющие работу этого фермента и следовательно предотвратить образование вирусных частиц. Для синтеза приведенной выше протеазы на автоматическом пептидном синтезаторе “Applied Biosystem” потребовалось около 200 химических процедур, не считая промывок, предшествующих каждой смене реагента. На завершающей стадии защищенный полипептид, ковалентно связанный со смолой, снимается с нее и защитные группы удаляются соответствующими обработками.

Глава 9. Биологические функции белков

Функции белков очень многообразны. Каждый данный белок как вещество с определенным химическим строением выполняет одну узкоспециализированную функцию и только в нескольких отдельных вариантах – несколько взаимосвязанных. К примеру, гормон мозгового слоя надпочечников адреналин, поступая в кровь, увеличивает потребление кислорода и артериальное давление, содержание сахара в крови, провоцирует обмен веществ, а также является медиатором нервной системы у холоднокровных животных.

1) Каталитическая (ферментативная) функция:

бессчетные биохимические реакции в живых ганизмах протекают в мягких условиях при температурах, близких к 40°С, и значениях рН близких к нейтральным. В этих условиях скорости протекания большинства реакций ничтожно малы, поэтому для их приемлемого воплощения необходимы особые биологические катализаторы – ферменты. Даже таковая обычная реакция, как дегидратация угольной к-ты:

CO2 + H2O HCO3-+ H+

катализируется ферментом карбоангидразой. Вообще все реакции, за исключением реакции фотолиза воды 2H2O®4H+ + 4e- + O2, в живых организмах катализируются ферментами. Как правило, ферменты – это или белки, или комплексы белков с каким-или кофактором – ионом сплава либо специальной органической молекулой. Ферменты владеют высокой, время от времени неповторимой, избирательностью деяния. К примеру, ферменты, катализирующие присоединение a-аминокислот к подходящим т-РНК в процессе биосинтеза белка, катализируют присоединение лишь L-аминокислот и не катализируют присоединение D-аминокислот.

2) Транспортная функция белков:

вовнутрь клеточки обязаны поступать бессчетные вещества, обеспечивающие её строительным материалом и энергией. В то же время все биологические мембраны построены по одному принципу – двойной слой липидов, в который погружены разные белки, причем гидрофильные участки макромолекул сосредоточены на поверхности мембран, а гидрофобные “хвосты” – в толще мембраны. Таковая структура непроницаема для таковых принципиальных компонентов, как сахара, аминокислоты, ионы щелочных металлов. Их проникновение вовнутрь клеточки осуществляется с помощью особых транспортных белков, встроенных в мембрану клеток. К примеру, у микробов имеется особый белок, обеспечивающий перенос через наружную мембрану молочного сахара – лактозы. Лактоза по интернациональной номенклатуре обозначается b-галаткозид, поэтому транспортный белок называют b-галактозидпермеазой.

принципиальным примером транспорта веществ через биологические мембраны против градиента концентрации является Na-K-ый насос. В ходе его работы происходит перенос трех положительных ионов Na+ из клеточки на каждые два положительных иона K+ в клеточку. Эта работа сопровождается скоплением электрической разности потенциалов на мембране клеточки. При этом расщепляется АТФ, давая энергию. Молекулярная база натрий-калиевого насоса была открыта не так давно, это оказался фермент, расщепляющий АТФ, – натрий-калийзависимая АТФ-аза. Насос действует по принципу открывающихся и закрывающихся каналов. Связывание молекул “канального” белка с ионом натрия приводит к нарушению системы водородных связей, в итоге чего изменяется его конформация. Рядовая a-спираль, в которой на каждый виток приходится по 3,6 аминокислотного остатка, переходит в более “рыхлую” p-спираль (4,4 аминокислотного остатка). В итоге появляется внутренняя полость, достаточная для прохождения иона натрия, но очень узенькая для иона калия. После прохождения Na+ p-спираль переходит в туго свернутую 310-спираль (на один виток 3 аминокислотных остатка, а водородная связь – у каждого 10-го атома). При этом натриевый канал закрывается, а стены соседнего калиевого канала расширяются, ионы калия проходят по ним в клеточку. Натрий-калиевый насос работает по принципу перистальтического насоса (напоминает продвижение пищевого комка по кишечнику), принцип деяния которого основан на переменном сжатии и расширении эластичных труб.

У многоклеточных организмов существует система транспорта веществ от одних органов к иным. В первую очередь это уже упоминавшийся в гл.6 (Стр.26) Гемоглобин. Не считая того, в плазме крови постоянно находится транспортный белок – сывороточный альбумин. Этот белок владеет неповторимой способностью образовывать прочный комплексы с жирными кислотами, образующимися при переваривании жиров, с некоторыми гидрофобными аминокислотами (к примеру, с триптофаном), со стероидными гормонами, а также со многими лекарственными продуктами, таковыми, как аспирин, сульфаниламиды, некие пенициллины. В качестве еще одного распространенного примера белка-переносчика можно привести трансферрин (обеспечивает перенос ионов железа) и церуплазмин (переносчик ионов меди).

3) Рецепторная функция:

огромное значение, в особенности для функционирования многоклеточных организмов, имеют белки-сенсоры, встроенные в плазматическую мембрану клеток и служащие для восприятия и преобразования разных сигналов, поступающих в клеточку, как от окружающей среды, так и от остальных клеток. В качестве более исследованных можно привести сенсоры ацетилхолина, находящиеся на мембране клеток в ряде межнейронных контактов, в том числе в коре головного мозга, и у нервно-мышечных соединений. Эти белки специфично взаимодействуют с ацетилхолином CH3C(O) – OCH2CH2N+(CH3)3 и отвечает на это передачей сигнала вовнутрь клеточки. После получения и преобразования сигнала нейромедиатор обязан быть удален, чтоб клеточка подготовилась к восприятию следующего сигнала. Для этого служит особый фермент – ацетилхолинэстераза, катализирующая гидролиз ацетилхолина до ацетата и холина.

Многие гормоны не попадают вовнутрь клеток-мишеней, а связываются со специфическими сенсорами на поверхности этих клеток. Такое связывание является сигналом, запускающим в клеточке физиологические процессы. Примером является действие гормона инсулина в аденилатциклазной системе. Сенсор к инсулину представляет собой гликопротеид, пронизывающий плазмалемму. При связывании гормона с рецепторной частью этого сложного белка в нем происходит активация каталитической внутренней части, представляющей фермент аденилатциклазу. Этот фермент синтезирует из АТФ циклическую аденозинмонофосфорную к-ту (цАМФ), которая в свою очередь катализирует ключевую стадию окисления полисахаридов – перевоплощение гликогена в мономерное производное глюкозы глюкозо-1-фосфат, который далее подвергается окислительной деструкции, сопровождающейся фосфорилированием огромного количества АДФ.

4) Защитная функция:

Иммунная система владеет способностью отвечать на появление чужеродных частиц выработкой большого числа лимфоцитов, способных специфически повреждать конкретно эти частицы, которыми могут быть чужеродные клеточки, к примеру патогенные бактерии, раковые клеточки, надмолекулярные частицы, такие как вирусы, макромолекулы, включая чужеродные белки. Одна из групп лимфоцитов – В-лимфоциты, производит особенные белки, выделяемые в кровеносную систему, которые узнают чужеродные частицы, образуя при этом высокоспецифичный комплекс на данной стадии ликвидирования. Эти белки именуются иммуноглобулины. Чужеродные вещества, вызывающие иммунный ответ называют антигенами, а соответствующие к ним иммуноглобулины – антителами. Если в роли антигена выступает крупная молекула, к примеру, молекула белка, то антитело опознает не всю молекулу, а её определенный участок, называемый антигенной детерминантой. Тот факт, что иммуноглобулины взаимодействуют со сравнимо маленький частью полимерного антигена, дозволяет производить антитела, специфично узнающие некие небольшие молекулы, не встречающиеся в живой природе. Классический пример – динитрофенильный остаток. При внедрении экспериментальным животным конъюгата динитрофенола с каким-или белком начинается выработка антител, специфично узнающих разные производные динитрофенола. Но при внедрении незапятнанного динитрофенола, иммунного ответа нет. Такие вещества, способные служить антигенными детерминантами, но сами не способные вызвать иммунный ответ, именуются гаптенами.

Антитела построены из четырех полипептидных цепей, связанных меж собой дисульфидными мостиками. Упрощенная схема строения иммуноглобулина класса G представлена на следующем рисунке.

Две полипептидные цепи имеют размер порядка 200 аминокислотных остатков и именуются легкими цепями (L-цепи). Две остальные вдвое больше по размеру и именуются тяжелыми цепями (H-цепи). На N-конце обеих цепей имеется вариабельная область размером немногим более 100 аминокислотных остатков, которая различна у иммуноглобулинов, настроенных на различные антигены – конкретно она описывает специфичность данной популяции лимфоцитов.

Вариабелная об-ласть сформировывает центр, непосред-ственно связыва-ющийся с опреде-ленным антиге-ном либо гаптеном остальная часть, составляющая у легкой цепи поло-вину молекулы, а у тяжеленной – ¾ , не зависит от вида иммуноглобу-лина. Эта область назы-вается кон-стантной.

СH СH

S

S

СL СL

S

S

СH2 СH2

S

S

СH3 СH3

Согласно современным представ-лениям, каждый тип иммуногло-булина вырабатывается группой В-лимфоцитов, произошедших от одного общего предшественника. Такую группу лимфоцитов называют клоном. Первые успехи в исследовании строения иммуноглобулинов были соединены с исследованием иммуноглобулинов, полученных от больных миеломой (патология, сплетенная со сверхпродукцией определенного вида иммуноглобулинов). У больных, от одного злокачественно разросшегося клона В-лимфоцитов, вырабатывается большущее количество личного иммуноглобулина, который сравнимо просто отделить от других. Далее производили слияние клеток миеломы как носителей способности к неограниченному размножению с нормальными В-лимфоцитами как носителями программы выработки антител определенной, задаваемой экспериментатором специфичности. Получающиеся клеточки, гибридомы сохраняют способность к неограниченному размножению и вырабатывают при этом лишь определенные антитела. Так как гибридомы происходят из одной слитой клеточки, то они представляют собой единый клон; получающиеся из них антитела поэтому называют моноклональными антителами (МАТ).

5) Структурная функция:

Наряду с белками, выполняющими тонкие высокоспециализирован-ные функции, есть белки, имеющие в основном структурное значение. Они обеспечивают механическую крепкость и остальные механические характеристики отдельных тканей живых организмов. В первую очередь это коллаген - основной белковый компонент внеклеточного матрикса соединительной ткани. У млекопитающих коллаген составляет до 25% общей массы белков. Коллаген синтезируется в фибробластах - главных клеточках соединительной ткани. Сначало он появляется в виде проколлагена - предшественника, который проходит в фибробластах определенную химическую обработку, состоящую в окислении остатков пролина до гидроксипролина и неких остатков лизина до d-гидроксилизина. Коллаген формируется в виде трех скрученных в спираль полипептидных цепей, которые уже вне фибробластов объединяются в коллагеновые фибриллы диаметром несколько сотен нанометров, а последние - уже в видимые под микроскопом коллагеновые нити.

В эластичных тканях - коже, стенах кровеносных сосудов, легких - кроме коллагена внеклеточный матрикс содержит белок эластин, способный достаточно в широких пределах растягиваться и возвращаться в исходное состояние.

Еще один пример структурного белка - фиброин шелка, выделяемый гусеницами шелкопряда в период формирования куколки и являющийся главным компонентом шелковых нитей.

6) Двигательные белки

Мышечное сокращение является действием, в ходе которого происходит перевоплощение химической энергии, запасенной в виде макроэргических пирофосфатных связей в молекулах АТФ, в механическую работу. Непосредственными участниками процесса сокращения являются два белка - актин и миозин.

Миозин представляет собой белок необыкновенного строения, состоящий из длинной нитевидной части (хвост) и двух глобулярных головок. Общественная длина одной молекулы составляет порядка 1600 нм, из которых на долю головок приходится около 200 нм. Миозин традиционно выделяется в виде гексамера, образованного двумя одинаковыми полипептидными цепями с молекулярной массой 200 000 любая (“тяжелые цепи”) и четырьмя “легкими цепями” с молекулярной массой около 20 000. Тяжелые цепи закручены спиралью одна вокруг другой, образуя хвост, и несут на одном конце глобулярные головки, ассоциированные с легкими цепями. На головках миозина находится два принципиальных функциональных центра - каталитический центр, способный в определенных условиях осуществлять гидролитическое расщепление b-g-пирофосфатной связи АТФ, и центр, обеспечивающий способность специфично связываться с иным мышечным белком - актином.

Актин является глобулярным белком с молекулярной массой 42 000. В таком виде его называют G-актином. Но он владеет способностью полимеризоваться, образуя длинную структуру, называемую F-актином. В таковой форме актин способен взаимодействовать с головкой миозина, причем принципиальной чертой этого процесса является зависимость от присутствия АТФ. При довольно высокой концентрации АТФ комплекс, образованный актином и миозином, разрушается. После того как под действием миозиновой АТФазы (фермент) произойдет гидролиз АТФ, комплекс опять восстанавливается. Этот процесс просто следить в растворе, содержащем оба белка. В отсутствии АТФ в итоге образования высокомолекулярного комплекса раствор становится вязким. При добавлении АТФ вязкость резко понижается в итоге разрушения комплекса, а потом начинает равномерно восстанавливаться по мере гидролиза АТФ. Эти взаимодействия играются важную роль в процессе мышечного сокращения.

7) лекарства:

огромную и очень важную в практическом отношении группу природных органических соединений составляют лекарства - вещества микробного происхождения, выделяемые особыми видами микроорганизмов и подавляющие рост остальных, конкурирующих микроорганизмов. Открытие и применение лекарств произвело в 40-ые гг. Революцию в лечении инфекционных заболеваний, вызываемых бактериями. Следует отметить, что на вирусы в большинстве случаев лекарства не действуют и применение их в качестве противовирусных препаратов неэффективно.

Первыми в практику были введены лекарства группы пенициллина. Примерами их могут служить бензилпенициллин и ампициллин:

CH3

CH3

N

N

Сходны с ним по строению лекарства группы цефалоспоринов, примером которых может служить цефамицин С. Общим у этих лекарств является наличие b-лактамного кольца. Механизм деяния их состоит в торможении одной из стадий формирования муреина - пептидогликана, формирующего клеточную стенку микробов.

лекарства очень многообразны по собственной химической природе и по механизму деяния. Некие из обширно используемых лекарств взаимодействуют с рибосомами микробов, тормозя синтез белка в бактериальных рибосомах, в то же время фактически не взаимодействуют с эукариотическими рибосомами. Поэтому они губительны для бактериальных клеток и не достаточно токсичны для человека и животных. К их числу относятся отлично известные стрептомицин, хлорамфеникол (левомицетин):

H3C

OH

NH

CHO

CH2OH

OH

О

OH

Левомицетин

Еще одним известным антибиотиком является тетрациклин:

Один из самых эффективных противотуберкулезных препаратов - антибиотик рифампицин - перекрывает работу прокариотических РНК-полимераз - ферментов, катализирующих биосинтез РНК, - связываясь ферментом, но в то же время не владеет способностью связываться с РНК-полимеразами эукариот:

Интенсивно исследуются лекарства, взаимодействующие с ДНК и этим нарушающие процессы, связанные с реализацией заложенной в ней наследственной информацией. Лекарства с таковым механизмом деяния традиционно высокотоксичны и употребляются лишь в химотерапии злокачественных опухолей. В качестве примера можно привести актиномицин D:

8) Токсины :

Ряд живых организмов в качестве защиты от возможных противников вырабатывают сильно ядовитые вещества - токсины. Многие из них являются белками, но, встречаются посреди них и сложные низкомолекулярные органические молекулы. В качестве примера такового вещества можно привести ядовитое начало белой поганки - a-аманитин:

Это соединение специфично перекрывает синтез эукариотических и-РНК. Для человека смертельной дозой является несколько мг этого токсина.

Глава 10. Заключение.

В последние десятилетия поменялся сам подход к решению основополагающих заморочек биологии. Один из основоположников молекулярной биологии, английский ученый, лауреат Нобелевской премии Джон Кендрью произнёс: “Биологи прежних лет в целом продвигались сверху вниз. Они начинали с целого организма, позже разнимали его на части и разглядывали отдельные органы и ткани; далее они изучали отдельные клеточки под микроскопом - так не достаточно-помалу они продвигались вниз от сложного к обычному. Новая биология начинает с другого конца и продвигается с самого низа вверх. Она начала с простых компонентов живого организма - стала учить отдельные молекулы и их взаимодействие внутри клеток, пренебрегая всем остальным. Сейчас пришла пора обратиться к этому остальному и двигаться вдоль иерархии биологической организации”.

но биология, сложнейшая необъятная наука, отнюдь не сводится к молекулярной биологии либо биоорганической химии. Они представляют собой только подходы к решению неких биологических задач. За последние четверть века на этом пути были сделаны блестящие, время от времени даже сенсационные открытия. Есть все основания полагать, что череда этих открытий еще не закончилась, как не закончилась еще революция в биологии.

перечень литературы:

1. В.Т.Иванов, А.Н.Шамин. Путь к синтезу белка. - Ленинград: Химия, Ленинградское отделение, 1982 г.

2. Д.Г.Кнорре, С.Д.Мызина. Биологическая химия. - М.: Высшая школа, 1998 г.

3. Р. Марри, Д. Греннер. Биохимия человека. Т. 1­-2 . - М.: Мир, 1993 г.

4. А.Уайт, Ф.Хендлер. базы биохимии. Т. 1-3. - М.: Мир, 1981 г.

5. Б.Албертс, Д.Брей. Молекулярная биология клеточки. Т. 1-3. М.: Мир, 1994 г.

6. Г.Шульц, Р.Ширмер. Принципы структурной организации белков. - М.: Мир, 1982 г.

7. А.О.Рувинский, В.К. Шумной. общественная биология. - М.: Просвещение, 1995 г.

8. Н.Н.Приходченко, Т.П.Шкурат. базы генетики человека. - Ростовна-Дону: Феникс, 1997 г.

9. В.Н.Ярыгин. Биология. Т. 1-2. - М.: Высшая школа, 1999 г.

ПРИЛОЖЕНИЕ

Приложение I

Аминокислота

Формула

Сокращение

3-х букв

1 букв.

Алифатические аминокислоты

Моноаминомонокарбоновые кислоты

1. Глицин (гликокол) аминоуксусная к-та

H –CH – COOH

|

NH2

Gly

G

2. Аланин, a-амино-пропионовая к-та

CH3 –CH – COOH

|

NH2

Ala

A

3. Валин, a-амино-изовалериановая к-та

CH3 – CH –CH – COOH

| |

CH3 NH2

Val

V

4. Лейцин, a-амино-изокапроновая к-та

CH3 – CH - СH2 –CH – COOH

| |

CH3 NH2

Leu

L

5.Изолейцин,

a-амино-

изокапроновая к-та

CH3 – CH2 - СH –CH – COOH

| |

CH3 NH2

Ile

I

6. Серин, a-амино-b-гидроксипропионовая к-та

CH2 –CH – COOH

| |

OH NH2

Ser

S

7. Треонин, a-амино--b-гидроксимасляная к-та

CH3 – CH –CH – COOH

| |

OH NH2

Thr

T

Диаминомонокарбновые кислоты

8. Лизин, a,e,-диаминокапроновая к-та

NH2 - CH2 - CH2 – CH2 - СH 2 –CH – COOH

|

NH2

Lys

K

9. Гидрокси-

лизин

(модификация лизина)

NH2 - CH2 – CH – CH2 - СH 2 –CH – COOH

| |

OH NH2

Hyl

10. Аргинин, a-амино-s-гуаниди-

валериановая к-та

NH2 - C – NH – CH2 – CH2 - СH 2 –CH – COOH

| | |

N NH2

Arg

R

Моноаминодикарбоновые кислоты и их амиды

11. Аспарагиновая к-та, a-аминоянтарная к-та

HOOC – CH2 –CH – COOH

|

NH2

Asp

D

12.Аспарагин,

NH2 - CO – CH2 –CH – COOH

|

NH2

Asn

N

13. Глутаминовая к-та, a-амино-

глутаровая к-та

HOOC – CH2 – CH2 –CH – COOH

|

NH2

Glu

E

13.Глутамин,

NH2 – CO – CH2 – CH2 –CH – COOH

|

NH2

Gln,

Glu

|

NH2

Q

Серусодержащие аминокислоты

14. Цистеин, a-амино-b-тиопропионовая к-та

HS – CH2 –CH – COOH

|

NH2

Cys

C

15. Цистин (модификация цистеина)

NH2

|

S – CH2 – CH – COOH

|

S – CH2 –CH – COOH

|

NH2

Cys

|

Cys

C

|

C

16.Метионин, a-амино-g-тиометил-масляная к-та

СH3 – S – СH2 – CH2 –CH – COOH

|

NH2

Met

M

17.Фенилаланин, a-амино-b-фенил-

пропионовая к-та

СH2 – CH – COOH

|

NH2

Phe

F

18.Тирозин, пара-гидроксифенил-

аланин

HO – – CH­2 – CH – COOH

|

NH2

Tyr

Y

NH

19. Триптофан, a-амино-b-индолил-пропионовая к-та

CH2 – CH – COOH

|

NH2

Try, Trp

W

20. Гистидин, a-амино-b-имида-золилпропионовая

к-та

N

CH2 – CH – COOH

|

NH NH2

His

H

Иминокислоты

21. Пролин

- СOOH

NH

Pro

P

Приложение II

Открытие аминокислот в составе белков

Аминокислота

Год

Источник

Кто в первый раз выделил

1. Глицин

1820

Желатина

А.Браконно

2. Лейцин

1820

Мышечные волокна

А.Браконно

1839

Фибрин, шерсть

Г.Мульдер

3. Тирозин

1848

Казеин

Ф.Бопп

4. Серин

1865

Шелк

Э.Крамер

5. Глутамино-

вая к-та

1866

Растительные белки

Г.Риттхаузен

6. Аспарагино-

вая к-та

1868

Конглутин, легумин

Г.Риттхаузен

7. Фенилаланин

1881

Ростки люпина

Э.Шульце, Й.Барбьери

8. Аланин

1888

Фиброин шелка

Т.Вейль

9. Лизин

1889

Казеин

Э.Дрексель

10. Аргинин

1895

Вещество рога

С.Хедин

11. Гистидин

1896

Стурин, гистоны

А.Коссель; С.Хедин

12. Цистин

1899

Вещество рога

К.Мёрнер

13. Валин

1901

Казеин

Э.Фишер

14. Пролин

1901

Казеин

Э.Фишер

15. Оксипролин

1902

Желатина

Э.Фишер

16. Триптофан

1902

Казеин

Ф.Гопкинс, Д.Кол

17. Изолейцин

1904

Фибрин

Ф.Эрлих

18. Метионин

1922

Казеин

Д. Мёллер

19. Треонин

1925

Белки овса

С.Шрайвер

20.Оксилизин

1925

Белки рыб

С.Шрайвер

Приложение III

Цветные реакции на белки

Цветные реакции используются для установления белковой природы веществ, идентификации белков и определение их аминокислотного состава в разных биологических жидкостях. В медицинской лабораторной практике эти способы употребляются для определения количества белка в плазме крови, аминокислот в моче и крови, для выявления наследственных и обретенных патологий обмена у новорожденных.

Биуретовая реакция на пептидную связь.

В базе её лежит способность пептидных связей (– CO–NH– ) образовывать с сульфатом меди в щелочной среде окрашенные комплексные соединения, интенсивность окраски которых зависит от длины полипептидной цепи. Раствор белка дает сине-фиолетовое окрашивание.

Реактивы: 1) яичный белок, 1% р-р (белок куриного яйца фильтруют через марлю и разводят дист-ой водой 1:10); 2) NaOH, 10% р-р; 3) Cu(OH)2, 1% р-р.

Ход определения. В пробирку вносят 5 капель р-ра яичного белка, 3 капли NaOH, 1 каплю Cu(OH)2, перемешивают. Содержимое пробирки приобретает сине-фиолетовое окрашивание.

Нингидриновая реакция.

Сущность реакции состоит в образовании соединения, окрашенного в сине-фиолетовый цвет, состоящего из нингидрина и товаров гидролиза аминокислот. Эта реакция характерна для аминогрупп в a-положении, присутствующих в природных аминокислотах и белках.

Реактивы: 1) яичный белок, 1% р-р; 2) нингидрин, 0,5% аква р-р.

Ход определения. В пробирку вносят 5 капель р-ра яичного белка, потом 5 капель нингидрина, нагревают смесь до кипения. Возникает розово-фиолетовое окрашивание, переходящее с течением времени в сине-фиолетовое.

Ксантопротеиновая реакция.

При добавлении к р-ру белка конц-ой азотной к-ты и нагревании возникает желтое окрашивание, переходящее в присутствии щелочи в оранжевое. Сущность реакции состоит в нитровании бензольного кольца циклических аминокислот азотной к-ой с образованием нитросоединений, выпадающих в осадок. Реакция выявляет наличие в белке циклических аминокислот.

Реактивы: 1) яичный белок, 1% р-р; 2) конц. Азотная к-та; 3)NaOH,10% р-р.

Ход определения. К 5 каплям р-ра яичного белка добавляют 3 капли азотной к-ты и (осторожно!) Нагревают. Возникает осадок желтого цвета. После остывания добавляют (лучше на осадок) 10 капель NaOH, возникает оранжевое окрашивание.

Реакция Адамкевича.

Аминокислота триптофан в кислой среде, взаимодействуя с альдегидами кислот, образует продукты конденсации красно-фиолетового цвета.

Реактивы: 1) неразбавленные яичный белок, 2) конц. (Ледяная) уксусная к-та; 3) конц. Серная к-та.

Ход определения. К одной капле белка добавляют 10 капель уксусной к-ты. Наклонив пробирку, осторожно по стенке добавляют по каплям 0,5 мл серной к-ты так, чтоб воды не смешивались. При стоянии пробирки на границе жидкостей возникает красно-фиолетовое кольцо.

Реакция Фоля.

Аминокислоты, содержащие сульфгидрильные группы – SH, подвергаются щелочному гидролизу с образованием сульфида натрия Na2S. Последний, взаимодействуя с плюмбитом натрия ( появляется в ходе реакции меж ацетатом свинца и NaOH), образует осадок сульфида свинца PbS темного либо бурого цвета.

Na2S + Na2PbO2 + 2H2O ® PbS¯ + 4NaOH.

Реактивы: 1) яичный белок, 1% р-р; 2) реактив Фоля ( к 5% -р-ру ацетата свинца добавляют равный размер 30% р-ра NaOH до растворения образовавшегося осадка).

Ход определения. К 5 каплям р-ра белка добавляют 5 капель реактива Фоля и кипятят 2-3 мин. После отстаивания 1-2 мин возникает темный либо бурый осадок.

Приложение IV

Реакции осаждения белков.

Белки в р-ре и соответственно в организме сохраняются в нативном состоянии за счет факторов стойкости, к которым относятся заряд белковой молекулы и гидратная оболочка вокруг нее. Удаление этих факторов приводит к склеиванию молекул белков и выпадению их в осадок. Осаждение белков может быть обратимым и необратимым в зависимости от реактивов и условий реакции. В медицинской лабораторной практике реакции осаждения употребляют для выделения альбуминовой и глобулиновой фракций белков плазмы крови, количественной свойства их стойкости в плазме, обнаружения белков в биологических жидкостях и освобождения от них с целью получения безбелкового р-ра.

Обратимое осаждение.

Под действием факторов осаждения белки выпадают в осадок, но после прекращения деяния (удаления) этих факторов белки вновь переходят в растворимое состояние и получают свои нативные характеристики. Одним из видов обратимого осаждения белков является высаливание.

Высаливание. Насыщенным р-ом сульфата аммония осаждается альбуминовая фракция белков, полунасыщенным р-ром – глобулиновая фракция.

Сущность реакции заключается в дегидратации молекул белка.

Реактивы: 1)неразведенный яичный белок; 2) насыщенный р-р сульфата аммония; 3) NaOH, 10% р-р, 4) CuSO4, 1% р-р; 5) дистл-ая вода; 6)сульфат аммония в порошке.

Ход определения. В пробирку наливают 30 капель неразв-го яичного белка и добавляют равное количество насыщенного р-ра сульфата аммония. Содержимое пробирки перемешивают. Получают полунасыщенный р-р сульфата аммония, при этом глобулиновая фракция осаждается, а альбуминовая остается в р-ре. Последнюю отфильтровывают, потом смешивают с порошком сульфата аммония до тех пор пока не прекратится раств-ие соли, при этом выпадает осадок – глобулины.

Необратимое осаждение белков.

Необратимое осаждение белков связано с глубокими нарушениями структуры белков (вторичной и третичной) и потерей ими нативных параметров. Такие конфигурации белков можно вызвать кипячением, действием конц. Р-ров минеральных и органических к-т, солями тяжелых металлов.

Осаждение при кипячении.

Белки являются термолабильными соединениями и при нагревании свыше 50-60°С денатурируются. Сущность тепловой денатурации заключается в разрушении гидратной оболочки, разрыве стабилизирующих белковую глобулу связей и развертывании белковой молекулы. Более полное и быстрое осаждение происходит в изоэлектрической точке (когда заряд молекулы равен нулю), поскольку частицы белка при этом наименее устойчивы. Белки, владеющие кислыми качествами, осаждаются в слабокислой среде, а белки с основными свойствми – в слабощелочной. В сильнокислых либо сильнощелочных р-рах денатурированный при нагревании белок в осадок не выпадает, т.К. Его частицы перезаряжаются и несут в первом случае положительный, а во втором – отрицательный заряд, что увеличивает их устойчивость в р-ре.

Реактивы: 1) яичный белок, 1% р-р; 2) уксусная к-та, 1% и 10% р-ры; 3) NaOH, 10% р-р.

Ход определения. В 4 пронумерованные пробирки приливают по 10 капель р-ра яичного белка. Потом 1-ю пробирку нагревают до кипячения, при этом р-р мутнеет, но т.К. Частицы денатурированного белка несут заряд, они в осадок не выпадают. Это связано с тем, что яичный белок имеет кислые характеристики ( его изоэлектрическая точка 4,8) и в нейтральной среде заряжен отрицательно; во вторую пробирку добавляют 1 каплю 1% р-ра уксусной к-ты и нагревают до кипячения. Белок выпадает в осадок, т.К. Его р-р приближается к изоэлектрической точке и белок теряет заряд ( один из факторов стойкости белка в р-ре); в 3-ю пробирку добавляют 1 каплю 10% р-ра уксусной к-ты и нагревают до кипения. Осадка не появляется, т.К. В сильнокислой среде частицы белка получают положительный заряд ( сохраняется один из факторов стойкости белка в р-ре); в 4-ю пробирку наливают 1 каплю р-ра NaOH, нагревают до кипения. Осадок не появляется, поскольку в щелочной среде отрицательный заряд белка возрастает.

Осаждение концентрированными минеральными к-тами.

Концентрированные кислоты (серная, хлористоводородная, азотная и др.) Вызывают денатурацию белка за счет удаления факторов стойкости белка в р-ре (заряда и гидратной оболочки). но при избытке хлористоводородной и серной к-т выпавший осадок денатурированного белка опять растворяется. По-видимому, это происходит в итоге перезарядки молекул белка и частичного их гидролиза. При добавлении избытка азотной к-ты растворения осадка не происходит. Вот почему для определения малых количеств белка в моче при клинических исследованиях применяется азотная к-та.

Реактивы: 1) яичный белок,1% р-р; 2) конц. Серная к-та; 3) конц. Хлористоводородная к-та; 4) конц. Азотная к-та.

Ход определения. В три пробирки наливают по 5 капель концентрированной серной, хлористоводородной и азотной к-т. Потом, наклонив пробирку под углом 45°, осторожно по стенке наслаивают таковой же размер яичного белка. На границе двух слоев возникает осадок белка в виде белого кольца. Осторожно встряхивают пробирки, наблюдают растворение белка в пробирках с серной и хлористоводородной к-тами, в пробирке с азотной к-ой растворения белка не происходит.

Осаждение органическими к-ами.

Трихлоруксусноая к-та осаждает лишь белки, а сульфосалициловая осаждает не лишь белки, но и высокомолекулярные пептиды. Сульфосалициловой к-ой пользуются при определении белка в моче.

Реактивы: 1) яичный белок, 1% р-р; 2) трихлоруксусная к-та, 10% р-р; 3) сульфосалициловая к-та, 10% р-р.

Ход определения. В две пробирки вносят по 5 капель р-ра белка. В одну из них добавляют 2 капли сульфосалициловой к-ты, а в другую – 5 капель трихлоруксусной к-ты. В пробирках выпадает осадок белка.

Осаждение белка солями тяжелых металлов.

Белки при содействии с солями свинца, меди, ртути, серебра и остальных тяжелых металлов денатурируются и выпадают в осадок. Но при избытке неких солей наблюдается растворение сначало образовавшегося осадка. Это связано с скоплением ионов сплава на поверхности денатурированного белка и появлением положительного заряда на белковой молекуле.

Реактивы: 1) яичный белок, 1% р-р; 2) сульфат меди, 10% р-р; 3) ацетат свинца, 5% р-р; 4) нитрат серебра, 5% р-р.

Ход определения. В три пробирки вносят по 5 капель белка. В первую добавляют 1 каплю ацетата свинца, в третью – 1 каплю нитрата серебра. Во всех пробирках выпадает осадок. Потом в первую пробирку добавляют 10 капель нитрата серебра – растворения осадка нет.



 
Еще рефераты и курсовые из раздела
Грибы - особенное царство живой природы
[pic] Выполнил: Полковников Иван. Проверила: Воробьёва Г. А 2005.г Содержание 1. Царство грибов……………………………3 - 4 2. Классификация……………………………4 – 10...

Про типографа
Про типографа Д. Хотин Речь пойдет не о производителе полиграфической продукции, а о жуках. Об организмах, живущих вокруг, кроме нас и наших знаний об окружающем...

Теории зарождения жизни на Земле
Вступление. Каждый человек хоть раз задавался вопросом о происхождении жизни на нашей планете. Вопрос очень увлекательный и загадочный, существует множество теории, любая из...

Синапсы (строение, структура, функции)
План работы: 1.Пролог. 2.Физиология нейрона и его строение. 3.Структура и функции синапса. 4.Химический синапс. 5.Выделение...

Абляционные материалы
Абляционные материалы Абляционные материалы (от позднелат. ablatio- отнятие, устранение), теплозащитные материалы, действие которых основано на абляции - сложном энергоемком процессе ...